👤 Jianfei Wang

🔍 Search 📋 Browse 🏷️ Tags ❤️ Favourites ➕ Add 🧬 Extraction
4397
Articles
2763
Name variants
Also published as: A Wang, Ai-Ling Wang, Ai-Ting Wang, Aihua Wang, Aijun Wang, Aili Wang, Aimin Wang, Aiting Wang, Aixian Wang, Aiyun Wang, Aizhong Wang, Alexander Wang, Alice Wang, Allen Wang, Anlai Wang, Anli Wang, Annette Wang, Anni Wang, Anqi Wang, Anthony Z Wang, Anxiang Wang, Anxin Wang, Ao Wang, Aoli Wang, B R Wang, B Wang, Baihan Wang, Baisong Wang, Baitao Wang, Bangchen Wang, Banghui Wang, Bangmao Wang, Bangshing Wang, Bao Wang, Bao-Long Wang, Baocheng Wang, Baofeng Wang, Baogui Wang, Baojun Wang, Baoli Wang, Baolong Wang, Baoming Wang, Baosen Wang, Baowei Wang, Baoying Wang, Baoyun Wang, Bei Bei Wang, Bei Wang, Beibei Wang, Beilan Wang, Beilei Wang, Ben Wang, Benjamin H Wang, Benzhong Wang, Bi Wang, Bi-Dar Wang, Biao Wang, Bicheng Wang, Bijue Wang, Bin Wang, Bin-Xue Wang, Binbin Wang, Bing Qing Wang, Bing Wang, Binghai Wang, Binghan Wang, Bingjie Wang, Binglong Wang, Bingnan Wang, Bingyan Wang, Bingyu Wang, Binquan Wang, Biqi Wang, Bo Wang, Bochu Wang, Boyu Wang, Bruce Wang, C Wang, C Z Wang, Cai Ren Wang, Cai-Hong Wang, Cai-Yun Wang, Cailian Wang, Caiqin Wang, Caixia Wang, Caiyan Wang, Can Wang, Cangyu Wang, Carol A Wang, Catherine Ruiyi Wang, Cenxuan Wang, Chan Wang, Chang Wang, Chang-Yun Wang, Changduo Wang, Changjing Wang, Changliang Wang, Changlong Wang, Changqian Wang, Changtu Wang, Changwei Wang, Changying Wang, Changyu Wang, Changyuan Wang, Changzhen Wang, Chao Wang, Chao-Jun Wang, Chao-Yung Wang, Chaodong Wang, Chaofan Wang, Chaohan Wang, Chaohui Wang, Chaojie Wang, Chaokui Wang, Chaomeng Wang, Chaoqun Wang, Chaoxian Wang, Chaoyi Wang, Chaoyu Wang, Chaozhan Wang, Charles C N Wang, Chau-Jong Wang, Chen Wang, Chen-Cen Wang, Chen-Ma Wang, Chen-Yu Wang, Chenchen Wang, Chenfei Wang, Cheng An Wang, Cheng Wang, Cheng-Cheng Wang, Cheng-Jie Wang, Cheng-zhang Wang, Chengbin Wang, Chengcheng Wang, Chenggang Wang, Chenghao Wang, Chenghua Wang, Chengjian Wang, Chengjun Wang, Chenglin Wang, Chenglong Wang, Chengniu Wang, Chengqiang Wang, Chengshuo Wang, Chenguang Wang, Chengwen Wang, Chengyan Wang, Chengyu Wang, Chengze Wang, Chenji Wang, Chenliang Wang, Chenwei Wang, Chenxi Wang, Chenxin Wang, Chenxuan Wang, Chenyang Wang, Chenyao Wang, Chenyin Wang, Chenyu Wang, Chenzi Wang, Chi Chiu Wang, Chi Wang, Chi-Ping Wang, Chia-Chuan Wang, Chia-Lin Wang, Chien-Hsun Wang, Chien-Wei Wang, Chih-Chun Wang, Chih-Hao Wang, Chih-Hsien Wang, Chih-Liang Wang, Chih-Yang Wang, Chih-Yuan Wang, Chijia Wang, Ching C Wang, Ching-Jen Wang, Chiou-Miin Wang, Chong Wang, Chongjian Wang, Chonglong Wang, Chongmin Wang, Chongze Wang, Christina Wang, Christine Wang, Chu Wang, Chuan Wang, Chuan-Chao Wang, Chuan-Hui Wang, Chuan-Jiang Wang, Chuan-Wen Wang, Chuang Wang, Chuanhai Wang, Chuansen Wang, Chuansheng Wang, Chuanxin Wang, Chuanyue Wang, Chuduan Wang, Chun Wang, Chun-Chieh Wang, Chun-Juan Wang, Chun-Li Wang, Chun-Lin Wang, Chun-Ting Wang, Chun-Xia Wang, Chung-Hsi Wang, Chung-Hsing Wang, Chung-Teng Wang, Chunguo Wang, Chunhong Wang, Chuning Wang, Chunjiong Wang, Chunjuan Wang, Chunle Wang, Chunli Wang, Chunlong Wang, Chunmei Wang, Chunsheng Wang, Chunting Wang, Chunxia Wang, Chunxue Wang, Chunyan Wang, Chunyang Wang, Chunyi Wang, Chunyu Wang, Chuyao Wang, Cindy Wang, Ciyang Wang, Cong Wang, Congcong Wang, Congrong Wang, Congrui Wang, Cui Wang, Cui-Fang Wang, Cui-Shan Wang, Cuili Wang, Cuiling Wang, Cuizhe Wang, Cun-Yu Wang, Cunchuan Wang, Cunyi Wang, D Wang, Da Wang, Da-Cheng Wang, Da-Li Wang, Da-Yan Wang, Da-Zhi Wang, Dadong Wang, Dai Wang, Daijun Wang, Daiwei Wang, Daixi Wang, Dajia Wang, Dake Wang, Dali Wang, Dalong Wang, Dalu Wang, Dan Wang, Dan-Dan Wang, Danan Wang, Dandan Wang, Danfeng Wang, Dang Wang, Dangfeng Wang, Danling Wang, Danqing Wang, Danxin Wang, Danyang Wang, Dao Wen Wang, Dao-Wen Wang, Dao-Xin Wang, Daolong Wang, Daoping Wang, Daozhong Wang, Dapeng Wang, Daping Wang, Daqi Wang, Daqing Wang, David Q H Wang, David Q-H Wang, David Wang, Dawei Wang, Dayan Wang, Dayong Wang, Dazhi Wang, De-He Wang, Dedong Wang, Dehao Wang, Deli Wang, Delin Wang, Delong Wang, Demin Wang, Deming Wang, Dengbin Wang, Dennis Qing Wang, Dennis Wang, Deqi Wang, Deshou Wang, Dezhong Wang, Di Wang, Dinghui Wang, Dingting Wang, Dingxiang Wang, Dong D Wang, Dong Hao Wang, Dong Wang, Dong-Dong Wang, Dong-Jie Wang, Dong-Mei Wang, DongWei Wang, Dongdong Wang, Donggen Wang, Donghao Wang, Donghong Wang, Donghui Wang, Dongliang Wang, Donglin Wang, Dongmei Wang, Dongqin Wang, Dongshi Wang, Dongxia Wang, Dongxu Wang, Dongyan Wang, Dongyang Wang, Dongyi Wang, Dongying Wang, Dongyu Wang, Doudou Wang, Du Wang, Duan Wang, Duanyang Wang, Duo-Ping Wang, E Wang, Edward Wang, En-bo Wang, En-hua Wang, Endi Wang, Enhua Wang, Er-Jin Wang, Erfei Wang, Erika Y Wang, Ermao Wang, Erming Wang, Ertao Wang, Eryao Wang, Eunice S Wang, Exing Wang, F Wang, Fa-Kai Wang, Fan Wang, Fanchang Wang, Fang Wang, Fang-Tao Wang, Fangfang Wang, Fangjie Wang, Fangjun Wang, Fangyan Wang, Fangyong Wang, Fangyu Wang, Fanhua Wang, Fanwen Wang, Fanxiong Wang, Fei Wang, Fei-Fei Wang, Fei-Yan Wang, Feida Wang, Feifei Wang, Feijie Wang, Feimiao Wang, Feixiang Wang, Feiyan Wang, Fen Wang, Feng Wang, Feng-Sheng Wang, Fengchong Wang, Fengge Wang, Fenghua Wang, Fengliang Wang, Fenglin Wang, Fengling Wang, Fengqiang Wang, Fengyang Wang, Fengying Wang, Fengyong Wang, Fengyun Wang, Fengzhen Wang, Fengzhong Wang, Fu Wang, Fu-Sheng Wang, Fu-Yan Wang, Fu-Zhen Wang, Fubao Wang, Fubing Wang, Fudi Wang, Fuhua Wang, Fuqiang Wang, Furong Wang, Fuwen Wang, Fuxin Wang, Fuyan Wang, G Q Wang, G Wang, G-W Wang, Gan Wang, Gang Wang, Ganggang Wang, Ganglin Wang, Gangyang Wang, Ganyu Wang, Gao T Wang, Gao Wang, Gaofu Wang, Gaopin Wang, Gavin Wang, Ge Wang, Geng Wang, Genghao Wang, Gengsheng Wang, Gongming Wang, Guan Wang, Guan-song Wang, Guandi Wang, Guanduo Wang, Guang Wang, Guang-Jie Wang, Guang-Rui Wang, Guangdi Wang, Guanghua Wang, Guanghui Wang, Guangliang Wang, Guangming Wang, Guangsuo Wang, Guangwen Wang, Guangyan Wang, Guangzhi Wang, Guanrou Wang, Guanru Wang, Guansong Wang, Guanyun Wang, Gui-Qi Wang, Guibin Wang, Guihu Wang, Guihua Wang, Guimin Wang, Guiping Wang, Guiqun Wang, Guixin Wang, Guixue Wang, Guiying Wang, Guo-Du Wang, Guo-Hua Wang, Guo-Liang Wang, Guo-Ping Wang, Guo-Quan Wang, Guo-hong Wang, GuoYou Wang, Guobin Wang, Guobing Wang, Guodong Wang, Guohang Wang, Guohao Wang, Guoliang Wang, Guoling Wang, Guoping Wang, Guoqian Wang, Guoqiang Wang, Guoqing Wang, Guorong Wang, Guowen Wang, Guoxiang Wang, Guoxiu Wang, Guoyi Wang, Guoying Wang, Guozheng Wang, H J Wang, H Wang, H X Wang, H Y Wang, H-Y Wang, Hai Bo Wang, Hai Wang, Hai Yang Wang, Hai-Feng Wang, Hai-Jun Wang, Hai-Long Wang, Haibin Wang, Haibing Wang, Haibo Wang, Haichao Wang, Haichuan Wang, Haifei Wang, Haifeng Wang, Haihe Wang, Haihong Wang, Haihua Wang, Haijiao Wang, Haijing Wang, Haijiu Wang, Haikun Wang, Hailei Wang, Hailin Wang, Hailing Wang, Hailong Wang, Haimeng Wang, Haina Wang, Haining Wang, Haiping Wang, Hairong Wang, Haitao Wang, Haiwei Wang, Haixia Wang, Haixin Wang, Haixing Wang, Haiyan Wang, Haiying Wang, Haiyong Wang, Haiyun Wang, Haizhen Wang, Han Wang, Hanbin Wang, Hanbing Wang, Hanchao Wang, Handong Wang, Hang Wang, Hangzhou Wang, Hanmin Wang, Hanping Wang, Hanqi Wang, Hanying Wang, Hanyu Wang, Hanzhi Wang, Hao Wang, Hao-Ching Wang, Hao-Hua Wang, Hao-Tian Wang, Hao-Yu Wang, Haobin Wang, Haochen Wang, Haohao Wang, Haohui Wang, Haojie Wang, Haolong Wang, Haomin Wang, Haoming Wang, Haonan Wang, Haoping Wang, Haoqi Wang, Haoran Wang, Haowei Wang, Haoxin Wang, Haoyang Wang, Haoyu Wang, Haozhou Wang, He Wang, He-Cheng Wang, He-Ling Wang, He-Ping Wang, He-Tong Wang, Hebo Wang, Hechuan Wang, Heling Wang, Hemei Wang, Heming Wang, Heng Wang, Heng-Cai Wang, Hengjiao Wang, Hengjun Wang, Hequn Wang, Hesuiyuan Wang, Heyong Wang, Hezhi Wang, Hong Wang, Hong Yi Wang, Hong-Gang Wang, Hong-Hui Wang, Hong-Kai Wang, Hong-Qin Wang, Hong-Wei Wang, Hong-Xia Wang, Hong-Yan Wang, Hong-Yang Wang, Hong-Ying Wang, Hongbin Wang, Hongbing Wang, Hongbo Wang, Hongcai Wang, Hongda Wang, Hongdan Wang, Hongfang Wang, Hongjia Wang, Hongjian Wang, Hongjie Wang, Hongjuan Wang, Hongkun Wang, Honglei Wang, Hongli Wang, Honglian Wang, Honglun Wang, Hongmei Wang, Hongpin Wang, Hongqian Wang, Hongshan Wang, Hongsheng Wang, Hongtao Wang, Hongwei Wang, Hongxia Wang, Hongxin Wang, Hongyan Wang, Hongyang Wang, Hongyi Wang, Hongyin Wang, Hongying Wang, Hongyu Wang, Hongyuan Wang, Hongyue Wang, Hongyun Wang, Hongze Wang, Hongzhan Wang, Hongzhuang Wang, Horng-Dar Wang, Houchun Wang, Hsei-Wei Wang, Hsueh-Chun Wang, Hu WANG, Hua Wang, Hua-Qin Wang, Hua-Wei Wang, Huabo Wang, Huafei Wang, Huai-Zhou Wang, Huaibing Wang, Huaili Wang, Huaizhi Wang, Huajin Wang, Huajing Wang, Hualin Wang, Hualing Wang, Huan Wang, Huan-You Wang, Huang Wang, Huanhuan Wang, Huanyu Wang, Huaquan Wang, Huating Wang, Huawei Wang, Huaxiang Wang, Huayang Wang, Huei Wang, Hui Miao Wang, Hui Wang, Hui-Hui Wang, Hui-Li Wang, Hui-Nan Wang, Hui-Yu Wang, HuiYue Wang, Huie Wang, Huiguo Wang, Huihua Wang, Huihui Wang, Huijie Wang, Huijun Wang, Huilun Wang, Huimei Wang, Huimin Wang, Huina Wang, Huiping Wang, Huiquan Wang, Huiqun Wang, Huishan Wang, Huiting Wang, Huiwen Wang, Huixia Wang, Huiyan Wang, Huiyang Wang, Huiyao Wang, Huiying Wang, Huiyu Wang, Huizhen Wang, Huizhi Wang, Huming Wang, I-Ching Wang, Iris X Wang, Isabel Z Wang, J J Wang, J P Wang, J Q Wang, J Wang, J Z Wang, J-Y Wang, Jacob E Wang, James Wang, Jeffrey Wang, Jen-Chun Wang, Jen-Chywan Wang, Jennifer E Wang, Jennifer T Wang, Jennifer X Wang, Jenny Y Wang, Jeremy R Wang, Jeremy Wang, Ji M Wang, Ji Wang, Ji-Nuo Wang, Ji-Yang Wang, Ji-Yao Wang, Ji-zheng Wang, Jia Bei Wang, Jia Bin Wang, Jia Wang, Jia-Liang Wang, Jia-Lin Wang, Jia-Mei Wang, Jia-Peng Wang, Jia-Qi Wang, Jia-Qiang Wang, Jia-Ying Wang, Jia-Yu Wang, Jiabei Wang, Jiabo Wang, Jiafeng Wang, Jiafu Wang, Jiahao Wang, Jiahui Wang, Jiajia Wang, Jiakun Wang, Jiale Wang, Jiali Wang, Jialiang Wang, Jialin Wang, Jialing Wang, Jiamin Wang, Jiaming Wang, Jian Wang, Jian'an Wang, Jian-Bin Wang, Jian-Guo Wang, Jian-Hong Wang, Jian-Long Wang, Jian-Wei Wang, Jian-Xiong Wang, Jian-Yong Wang, Jian-Zhi Wang, Jian-chun Wang, Jianan Wang, Jianbing Wang, Jianbo Wang, Jianding Wang, Jianfang Wang, Jiang Wang, Jiangbin Wang, Jiangbo Wang, Jianghua Wang, Jianghui Wang, Jiangong Wang, Jianguo Wang, Jianhao Wang, Jianhua Wang, Jianhui Wang, Jiani Wang, Jianjiao Wang, Jianjie Wang, Jianjun Wang, Jianle Wang, Jianli Wang, Jianlin Wang, Jianliu Wang, Jianlong Wang, Jianmei Wang, Jianmin Wang, Jianning Wang, Jianping Wang, Jianqin Wang, Jianqing Wang, Jianqun Wang, Jianru Wang, Jianshe Wang, Jianshu Wang, Jiantao Wang, Jianwei Wang, Jianwu Wang, Jianxiang Wang, Jianxin Wang, Jianye Wang, Jianying Wang, Jianyong Wang, Jianyu Wang, Jianzhang Wang, Jianzhi Wang, Jiao Wang, Jiaojiao Wang, Jiapan Wang, Jiaping Wang, Jiaqi Wang, Jiaqian Wang, Jiatao Wang, Jiawei Wang, Jiawen Wang, Jiaxi Wang, Jiaxin Wang, Jiaxing Wang, Jiaxuan Wang, Jiayan Wang, Jiayang Wang, Jiayi Wang, Jiaying Wang, Jiayu Wang, Jiazheng Wang, Jiazhi Wang, Jie Jin Wang, Jie Wang, Jieda Wang, Jieh-Neng Wang, Jiemei Wang, Jieqi Wang, Jieyan Wang, Jieyu Wang, Jifei Wang, Jiheng Wang, Jihong Wang, Jiliang Wang, Jilin Wang, Jin Wang, Jin'e Wang, Jin-Bao Wang, Jin-Cheng Wang, Jin-Da Wang, Jin-E Wang, Jin-Juan Wang, Jin-Liang Wang, Jin-Xia Wang, Jin-Xing Wang, Jincheng Wang, Jindan Wang, Jinfei Wang, Jinfeng Wang, Jinfu Wang, Jing J Wang, Jing Wang, Jing-Hao Wang, Jing-Huan Wang, Jing-Jing Wang, Jing-Long Wang, Jing-Min Wang, Jing-Shi Wang, Jing-Wen Wang, Jing-Xian Wang, Jing-Yi Wang, Jing-Zhai Wang, Jingang Wang, Jingchun Wang, Jingfan Wang, Jingfeng Wang, Jingheng Wang, Jinghong Wang, Jinghua Wang, Jinghuan Wang, Jingjing Wang, Jingkang Wang, Jinglin Wang, Jingmin Wang, Jingnan Wang, Jingqi Wang, Jingru Wang, Jingtong Wang, Jingwei Wang, Jingwen Wang, Jingxiao Wang, Jingyang Wang, Jingyi Wang, Jingying Wang, Jingyu Wang, Jingyue Wang, Jingyun Wang, Jingzhou Wang, Jinhai Wang, Jinhao Wang, Jinhe Wang, Jinhua Wang, Jinhuan Wang, Jinhui Wang, Jinjie Wang, Jinjin Wang, Jinkang Wang, Jinling Wang, Jinlong Wang, Jinmeng Wang, Jinning Wang, Jinping Wang, Jinqiu Wang, Jinrong Wang, Jinru Wang, Jinsong Wang, Jintao Wang, Jinxia Wang, Jinxiang Wang, Jinyang Wang, Jinyu Wang, Jinyue Wang, Jinyun Wang, Jinzhu Wang, Jiou Wang, Jipeng Wang, Jiqing Wang, Jiqiu Wang, Jisheng Wang, Jiu Wang, Jiucun Wang, Jiun-Ling Wang, Jiwen Wang, Jixuan Wang, Jiyan Wang, Jiying Wang, Jiyong Wang, Jizheng Wang, John Wang, Jou-Kou Wang, Joy Wang, Ju Wang, Juan Wang, Jue Wang, Jueqiong Wang, Jufeng Wang, Julie Wang, Juling Wang, Jun Kit Wang, Jun Wang, Jun Yi Wang, Jun-Feng Wang, Jun-Jie Wang, Jun-Jun Wang, Jun-Ling Wang, Jun-Sheng Wang, Jun-Sing Wang, Jun-Zhuo Wang, Jundong Wang, Junfeng Wang, Jung-Pan Wang, Junhong Wang, Junhua Wang, Junhui Wang, Junjiang Wang, Junjie Wang, Junjun Wang, Junkai Wang, Junke Wang, Junli Wang, Junlin Wang, Junling Wang, Junmei Wang, Junmin Wang, Junpeng Wang, Junping Wang, Junqin Wang, Junqing Wang, Junrui Wang, Junsheng Wang, Junshi Wang, Junshuang Wang, Junwen Wang, Junxiao Wang, Junya Wang, Junying Wang, Junyu Wang, Justin Wang, Jutao Wang, Juxiang Wang, K Wang, Kai Wang, Kai-Kun Wang, Kai-Wen Wang, Kaicen Wang, Kaihao Wang, Kaihe Wang, Kaihong Wang, Kaijie Wang, Kaijuan Wang, Kailu Wang, Kaiming Wang, Kaining Wang, Kaiting Wang, Kaixi Wang, Kaixu Wang, Kaiyan Wang, Kaiyuan Wang, Kaiyue Wang, Kan Wang, Kangli Wang, Kangling Wang, Kangmei Wang, Kangning Wang, Ke Wang, Ke-Feng Wang, KeShan Wang, Kehan Wang, Kehao Wang, Kejia Wang, Kejian Wang, Kejun Wang, Keke Wang, Keming Wang, Kenan Wang, Keqing Wang, Kesheng Wang, Kexin Wang, Keyan Wang, Keyi Wang, Keyun Wang, Kongyan Wang, Kuan Hong Wang, Kui Wang, Kun Wang, Kunhua Wang, Kunpeng Wang, Kunzheng Wang, L F Wang, L M Wang, L Wang, L Z Wang, L-S Wang, Laidi Wang, Laijian Wang, Laiyuan Wang, Lan Wang, Lan-Wan Wang, Lan-lan Wang, Lanlan Wang, Larry Wang, Le Wang, Le-Xin Wang, Ledan Wang, Lee-Kai Wang, Lei P Wang, Lei Wang, Lei-Lei Wang, Leiming Wang, Leishen Wang, Leli Wang, Leran Wang, Lexin Wang, Leying Wang, Li Chun Wang, Li Dong Wang, Li Wang, Li-Dong Wang, Li-E Wang, Li-Juan Wang, Li-Li Wang, Li-Na Wang, Li-San Wang, Li-Ting Wang, Li-Xin Wang, Li-Yong Wang, LiLi Wang, Lian Wang, Lianchun Wang, Liang Wang, Liang-Yan Wang, Liangfu Wang, Lianghai Wang, Liangli Wang, Liangliang Wang, Liangxu Wang, Lianshui Wang, Lianyong Wang, Libo Wang, Lichan Wang, Lichao Wang, Liewei Wang, Lifang Wang, Lifei Wang, Lifen Wang, Lifeng Wang, Ligang Wang, Lihong Wang, Lihua Wang, Lihui Wang, Lijia Wang, Lijin Wang, Lijing Wang, Lijuan Wang, Lijun Wang, Liling Wang, Lily Wang, Limeng Wang, Limin Wang, Liming Wang, Lin Wang, Lin-Fa Wang, Lin-Yu Wang, Lina Wang, Linfang Wang, Ling Jie Wang, Ling Wang, Ling-Ling Wang, Lingbing Wang, Lingda Wang, Linghua Wang, Linghuan Wang, Lingli Wang, Lingling Wang, Lingyan Wang, Lingzhi Wang, Linhua Wang, Linhui Wang, Linjie Wang, Linli Wang, Linlin Wang, Linping Wang, Linshu Wang, Linshuang Wang, Lintao Wang, Linxuan Wang, Linying Wang, Linyuan Wang, Liping Wang, Liqing Wang, Liqun Wang, Lirong Wang, Litao Wang, Liting Wang, Liu Wang, Liusong Wang, Liuyang Wang, Liwei Wang, Lixia Wang, Lixian Wang, Lixiang Wang, Lixin Wang, Lixing Wang, Lixiu Wang, Liyan Wang, Liyi Wang, Liying Wang, Liyong Wang, Liyuan Wang, Liyun Wang, Long Wang, Longcai Wang, Longfei Wang, Longsheng Wang, Longxiang Wang, Lou-Pin Wang, Lu Wang, Lu-Lu Wang, Lueli Wang, Lufang Wang, Luhong Wang, Luhui Wang, Lujuan Wang, Lulu Wang, Luofu Wang, Luping Wang, Luting Wang, Luwen Wang, Luxiang Wang, Luya Wang, Luyao Wang, Luyun Wang, Lynn Yuning Wang, M H Wang, M Wang, M Y Wang, M-J Wang, Maiqiu Wang, Man Wang, Mangju Wang, Manli Wang, Mao-Xin Wang, Maochun Wang, Maojie Wang, Maoju Wang, Mark Wang, Mei Wang, Mei-Gui Wang, Mei-Xia Wang, Meiding Wang, Meihui Wang, Meijun Wang, Meiling Wang, Meixia Wang, Melissa T Wang, Meng C Wang, Meng Wang, Meng Yu Wang, Meng-Dan Wang, Meng-Lan Wang, Meng-Meng Wang, Meng-Ru Wang, Meng-Wei Wang, Meng-Ying Wang, Meng-hong Wang, Mengge Wang, Menghan Wang, Menghui Wang, Mengjiao Wang, Mengjing Wang, Mengjun Wang, Menglong Wang, Menglu Wang, Mengmeng Wang, Mengqi Wang, Mengru Wang, Mengshi Wang, Mengwen Wang, Mengxiao Wang, Mengya Wang, Mengyao Wang, Mengying Wang, Mengyuan Wang, Mengyue Wang, Mengyun Wang, Mengze Wang, Mengzhao Wang, Mengzhi Wang, Mian Wang, Miao Wang, Mimi Wang, Min Wang, Min-sheng Wang, Ming Wang, Ming-Chih Wang, Ming-Hsi Wang, Ming-Jie Wang, Ming-Wei Wang, Ming-Yang Wang, Ming-Yuan Wang, Mingchao Wang, Mingda Wang, Minghua Wang, Minghuan Wang, Minghui Wang, Mingji Wang, Mingjin Wang, Minglei Wang, Mingliang Wang, Mingmei Wang, Mingming Wang, Mingqiang Wang, Mingrui Wang, Mingsong Wang, Mingxi Wang, Mingxia Wang, Mingxun Wang, Mingya Wang, Mingyang Wang, Mingyi Wang, Mingyu Wang, Mingzhi Wang, Mingzhu Wang, Minjie Wang, Minjun Wang, Minmin Wang, Minxian Wang, Minxiu Wang, Minzhou Wang, Miranda C Wang, Mo Wang, Mofei Wang, Monica Wang, Mu Wang, Mutian Wang, Muxiao Wang, Muxuan Wang, N Wang, Na Wang, Nan Wang, Nana Wang, Nanbu Wang, Nannan Wang, Nanping Wang, Neng Wang, Ni Wang, Niansong Wang, Ning Wang, Ningjian Wang, Ningli Wang, Ningyuan Wang, Nuan Wang, Oliver Wang, Ouchen Wang, P Jeremy Wang, P L Wang, P N Wang, P Wang, Pai Wang, Pan Wang, Pan-Pan Wang, Panfeng Wang, Panliang Wang, Pei Chang Wang, Pei Wang, Pei-Hua Wang, Pei-Jian Wang, Pei-Juan Wang, Pei-Wen Wang, Pei-Yu Wang, Peichang Wang, Peigeng Wang, Peihe Wang, Peijia Wang, Peijuan Wang, Peijun Wang, Peilin Wang, Peipei Wang, Peirong Wang, Peiwen Wang, Peixi Wang, Peiyao Wang, Peiyin Wang, Peng Wang, Peng-Cheng Wang, Pengbo Wang, Pengchao Wang, Pengfei Wang, Pengjie Wang, Pengju Wang, Penglai Wang, Penglong Wang, Pengpu Wang, Pengtao Wang, Pengxiang Wang, Pengyu Wang, Pin Wang, Ping Wang, Pingchuan Wang, Pingfeng Wang, Pingping Wang, Pintian Wang, Po-Jen Wang, Pu Wang, Q Wang, Q Z Wang, Qi Wang, Qi-Bing Wang, Qi-En Wang, Qi-Jia Wang, Qi-Qi Wang, Qian Wang, Qian-Liang Wang, Qian-Wen Wang, Qian-Zhu Wang, Qian-fei Wang, Qianbao Wang, Qiang Wang, Qiang-Sheng Wang, Qiangcheng Wang, Qianghu Wang, Qiangqiang Wang, Qianjin Wang, Qianliang Wang, Qianqian Wang, Qianrong Wang, Qianru Wang, Qianwen Wang, Qianxu Wang, Qiao Wang, Qiao-Ping Wang, Qiaohong Wang, Qiaoqi Wang, Qiaoqiao Wang, Qifan Wang, Qifei Wang, Qifeng Wang, Qigui Wang, Qihao Wang, Qihua Wang, Qijia Wang, Qiming Wang, Qin Wang, Qing Jun Wang, Qing K Wang, Qing Kenneth Wang, Qing Mei Wang, Qing Wang, Qing-Bin Wang, Qing-Dong Wang, Qing-Jin Wang, Qing-Liang Wang, Qing-Mei Wang, Qing-Yan Wang, Qing-Yuan Wang, Qing-Yun Wang, QingDong Wang, Qingchun Wang, Qingfa Wang, Qingfeng Wang, Qinghang Wang, Qingliang Wang, Qinglin Wang, Qinglu Wang, Qingming Wang, Qingping Wang, Qingqing Wang, Qingshi Wang, Qingshui Wang, Qingsong Wang, Qingtong Wang, Qingyong Wang, Qingyu Wang, Qingyuan Wang, Qingyun Wang, Qingzhong Wang, Qinqin Wang, Qinrong Wang, Qintao Wang, Qinwen Wang, Qinyun Wang, Qiong Wang, Qiqi Wang, Qirui Wang, Qishan Wang, Qiu-Ling Wang, Qiu-Xia Wang, Qiuhong Wang, Qiuli Wang, Qiuling Wang, Qiuning Wang, Qiuping Wang, Qiushi Wang, Qiuting Wang, Qiuyan Wang, Qiuyu Wang, Qiwei Wang, Qixue Wang, Qiyu Wang, Qiyuan Wang, Quan Wang, Quan-Ming Wang, Quanli Wang, Quanren Wang, Quanxi Wang, Qun Wang, Qunxian Wang, Qunzhi Wang, R Wang, Ran Wang, Ranjing Wang, Ranran Wang, Re-Hua Wang, Ren Wang, Rencheng Wang, Renjun Wang, Renqian Wang, Renwei Wang, Renxi Wang, Renxiao Wang, Renyuan Wang, Rihua Wang, Rikang Wang, Rixiang Wang, Robert Yl Wang, Rong Wang, Rong-Chun Wang, Rong-Rong Wang, Rong-Tsorng Wang, RongRong Wang, Rongjia Wang, Rongping Wang, Rongyun Wang, Ru Wang, RuNan Wang, Ruey-Yun Wang, Rufang Wang, Ruhan Wang, Rui Wang, Rui-Hong Wang, Rui-Min Wang, Rui-Ping Wang, Rui-Rui Wang, Ruibin Wang, Ruibing Wang, Ruibo Wang, Ruicheng Wang, Ruifang Wang, Ruijing Wang, Ruimeng Wang, Ruimin Wang, Ruiming Wang, Ruinan Wang, Ruining Wang, Ruiquan Wang, Ruiwen Wang, Ruixian Wang, Ruixin Wang, Ruixuan Wang, Ruixue Wang, Ruiying Wang, Ruizhe Wang, Ruizhi Wang, Rujie Wang, Ruling Wang, Ruming Wang, Runci Wang, Runuo Wang, Runze Wang, Runzhi Wang, Ruo-Nan Wang, Ruo-Ran Wang, Ruonan Wang, Ruosu Wang, Ruoxi Wang, Rurong Wang, Ruting Wang, Ruxin Wang, Ruxuan Wang, Ruyue Wang, S L Wang, S S Wang, S Wang, S X Wang, Sa A Wang, Sa Wang, Saifei Wang, Saili Wang, Sainan Wang, Saisai Wang, Sangui Wang, Sanwang Wang, Sasa Wang, Sen Wang, Seok Mui Wang, Seungwon Wang, Sha Wang, Shan Wang, Shan-Shan Wang, Shang Wang, Shangyu Wang, Shanshan Wang, Shao-Kang Wang, Shaochun Wang, Shaohsu Wang, Shaokun Wang, Shaoli Wang, Shaolian Wang, Shaoshen Wang, Shaowei Wang, Shaoyi Wang, Shaoying Wang, Shaoyu Wang, Shaozheng Wang, Shasha Wang, Shau-Chun Wang, Shawn Wang, Shen Wang, Shen-Nien Wang, Shenao Wang, Sheng Wang, Sheng-Min Wang, Sheng-Nan Wang, Sheng-Ping Wang, Sheng-Quan Wang, Sheng-Yang Wang, Shengdong Wang, Shengjie Wang, Shengli Wang, Shengqi Wang, Shengya Wang, Shengyao Wang, Shengyu Wang, Shengyuan Wang, Shenqi Wang, Sheri Wang, Shi Wang, Shi-Cheng Wang, Shi-Han Wang, Shi-Qi Wang, Shi-Xin Wang, Shi-Yao Wang, Shibin Wang, Shichao Wang, Shicung Wang, Shidong Wang, Shifa Wang, Shifeng Wang, Shih-Wei Wang, Shihan Wang, Shihao Wang, Shihua Wang, Shijie Wang, Shijin Wang, Shijun Wang, Shikang Wang, Shimiao Wang, Shiqi Wang, Shiqiang Wang, Shitao Wang, Shitian Wang, Shiwen Wang, Shixin Wang, Shixuan Wang, Shiyang Wang, Shiyao Wang, Shiyin Wang, Shiyu Wang, Shiyuan Wang, Shiyue Wang, Shizhi Wang, Shouli Wang, Shouling Wang, Shouzhi Wang, Shu Wang, Shu-Huei Wang, Shu-Jin Wang, Shu-Ling Wang, Shu-Na Wang, Shu-Song Wang, Shu-Xia Wang, Shu-qiang Wang, Shuai Wang, Shuaiqin Wang, Shuang Wang, Shuang-Shuang Wang, Shuang-Xi Wang, Shuangyuan Wang, Shubao Wang, Shudan Wang, Shuge Wang, Shuguang Wang, Shuhe Wang, Shuiliang Wang, Shuiyun Wang, Shujin Wang, Shukang Wang, Shukui Wang, Shun Wang, Shuning Wang, Shunjun Wang, Shunran Wang, Shuo Wang, Shuping Wang, Shuqi Wang, Shuqing Wang, Shuren Wang, Shusen Wang, Shusheng Wang, Shushu Wang, Shuu-Jiun Wang, Shuwei Wang, Shuxia Wang, Shuxin Wang, Shuya Wang, Shuye Wang, Shuyue Wang, Shuzhe Wang, Shuzhen Wang, Shuzhong Wang, Shyi-Gang P Wang, Si Wang, Sibo Wang, Sidan Wang, Sihua Wang, Sijia Wang, Silas L Wang, Silu Wang, Simeng Wang, Siqi Wang, Siqing Wang, Siwei Wang, Siyang Wang, Siyi Wang, Siying Wang, Siyu Wang, Siyuan Wang, Siyue Wang, Song Wang, Songjiao Wang, Songlin Wang, Songping Wang, Songsong Wang, Songtao Wang, Sophie H Wang, Stephani Wang, Su'e Wang, Su-Guo Wang, Su-Hua Wang, Sufang Wang, Sugai Wang, Sui Wang, Suiyan Wang, Sujie Wang, Sujuan Wang, Suli Wang, Sun Wang, Supeng Perry Wang, Suxia Wang, Suyun Wang, Suzhen Wang, T Q Wang, T Wang, T Y Wang, Taian Wang, Taicheng Wang, Taishu Wang, Tammy C Wang, Tao Wang, Taoxia Wang, Teng Wang, Tengfei Wang, Theodore Wang, Thomas T Y Wang, Tian Wang, Tian-Li Wang, Tian-Lu Wang, Tian-Tian Wang, Tian-Yi Wang, Tiancheng Wang, Tiange Wang, Tianhao Wang, Tianhu Wang, Tianhui Wang, Tianjing Wang, Tianjun Wang, Tianlin Wang, Tiannan Wang, Tianpeng Wang, Tianqi Wang, Tianqin Wang, Tianqing Wang, Tiansheng Wang, Tiansong Wang, Tiantian Wang, Tianyi Wang, Tianying Wang, Tianyuan Wang, Tielin Wang, Tienju Wang, Tieqiao Wang, Timothy C Wang, Ting Chen Wang, Ting Wang, Ting-Chen Wang, Ting-Hua Wang, Ting-Ting Wang, Tingting Wang, Tingye Wang, Tingyu Wang, Tom J Wang, Tong Wang, Tong-Hong Wang, Tongsong Wang, Tongtong Wang, Tongxia Wang, Tongxin Wang, Tongyao Wang, Tony Wang, Tzung-Dau Wang, Victoria Wang, Vivian Wang, W Wang, Wanbing Wang, Wanchun Wang, Wang Wang, Wangxia Wang, Wanliang Wang, Wanxia Wang, Wanyao Wang, Wanyi Wang, Wanyu Wang, Wayseen Wang, Wei Wang, Wei-En Wang, Wei-Feng Wang, Wei-Lien Wang, Wei-Qi Wang, Wei-Ting Wang, Wei-Wei Wang, Weicheng Wang, Weiding Wang, Weidong Wang, Weifan Wang, Weiguang Wang, Weihao Wang, Weihong Wang, Weihua Wang, Weijian Wang, Weijie Wang, Weijun Wang, Weilin Wang, Weiling Wang, Weilong Wang, Weimin Wang, Weina Wang, Weining Wang, Weipeng Wang, Weiqin Wang, Weiqing Wang, Weirong Wang, Weiwei Wang, Weiwen Wang, Weixiao Wang, Weixue Wang, Weiyan Wang, Weiyu Wang, Weiyuan Wang, Weizhen Wang, Weizhi Wang, Weizhong Wang, Wen Wang, Wen-Chang Wang, Wen-Der Wang, Wen-Fei Wang, Wen-Jie Wang, Wen-Jun Wang, Wen-Qing Wang, Wen-Xuan Wang, Wen-Yan Wang, Wen-Ying Wang, Wen-Yong Wang, Wen-mei Wang, Wenbin Wang, Wenbo Wang, Wence Wang, Wenchao Wang, Wencheng Wang, Wendong Wang, Wenfei Wang, Wengong Wang, Wenhan Wang, Wenhao Wang, Wenhe Wang, Wenhui Wang, Wenjie Wang, Wenjing Wang, Wenju Wang, Wenjuan Wang, Wenjun Wang, Wenkai Wang, Wenkang Wang, Wenke Wang, Wenming Wang, Wenqi Wang, Wenqiang Wang, Wenqing Wang, Wenran Wang, Wenrui Wang, Wentao Wang, Wentian Wang, Wenting Wang, Wenwen Wang, Wenxia Wang, Wenxian Wang, Wenxiang Wang, Wenxiu Wang, Wenxuan Wang, Wenya Wang, Wenyan Wang, Wenyi Wang, Wenying Wang, Wenyu Wang, Wenyuan Wang, Wenzhou Wang, William Wang, Won-Jing Wang, Wu-Wei Wang, Wuji Wang, Wuqing Wang, Wusan Wang, X E Wang, X F Wang, X O Wang, X S Wang, X Wang, X-T Wang, Xi Wang, Xi-Hong Wang, Xi-Rui Wang, Xia Wang, Xian Wang, Xian-e Wang, Xianding Wang, Xianfeng Wang, Xiang Wang, Xiang-Dong Wang, Xiangcheng Wang, Xiangding Wang, Xiangdong Wang, Xiangguo Wang, Xianghua Wang, Xiangkun Wang, Xiangrong Wang, Xiangru Wang, Xiangwei Wang, Xiangyu Wang, Xianna Wang, Xianqiang Wang, Xianrong Wang, Xianshi Wang, Xianshu Wang, Xiansong Wang, Xiantao Wang, Xianwei Wang, Xianxing Wang, Xianze Wang, Xianzhe Wang, Xianzong Wang, Xiao Ling Wang, Xiao Qun Wang, Xiao Wang, Xiao-Ai Wang, Xiao-Fei Wang, Xiao-Hui Wang, Xiao-Jie Wang, Xiao-Juan Wang, Xiao-Lan Wang, Xiao-Li Wang, Xiao-Lin Wang, Xiao-Ming Wang, Xiao-Pei Wang, Xiao-Qian Wang, Xiao-Qun Wang, Xiao-Tong Wang, Xiao-Xia Wang, Xiao-Yi Wang, Xiao-Yun Wang, Xiao-jian WANG, Xiao-liang Wang, Xiaobin Wang, Xiaobo Wang, Xiaochen Wang, Xiaochuan Wang, Xiaochun Wang, Xiaodan Wang, Xiaoding Wang, Xiaodong Wang, Xiaofang Wang, Xiaofei Wang, Xiaofen Wang, Xiaofeng Wang, Xiaogang Wang, Xiaohong Wang, Xiaohu Wang, Xiaohua Wang, Xiaohui Wang, Xiaojia Wang, Xiaojian Wang, Xiaojiao Wang, Xiaojie Wang, Xiaojing Wang, Xiaojuan Wang, Xiaojun Wang, Xiaokun Wang, Xiaole Wang, Xiaoli Wang, Xiaoliang Wang, Xiaolin Wang, Xiaoling Wang, Xiaolong Wang, Xiaolu Wang, Xiaolun Wang, Xiaoman Wang, Xiaomei Wang, Xiaomeng Wang, Xiaomin Wang, Xiaoming Wang, Xiaona Wang, Xiaonan Wang, Xiaoning Wang, Xiaoqi Wang, Xiaoqian Wang, Xiaoqin Wang, Xiaoqing Wang, Xiaoqiu Wang, Xiaoqun Wang, Xiaorong Wang, Xiaorui Wang, Xiaoshan Wang, Xiaosong Wang, Xiaotang Wang, Xiaoting Wang, Xiaotong Wang, Xiaowei Wang, Xiaowen Wang, Xiaowu Wang, Xiaoxia Wang, Xiaoxiao Wang, Xiaoxin Wang, Xiaoxin X Wang, Xiaoxuan Wang, Xiaoya Wang, Xiaoyan Wang, Xiaoyang Wang, Xiaoye Wang, Xiaoying Wang, Xiaoyu Wang, Xiaozhen Wang, Xiaozhi Wang, Xiaozhong Wang, Xiaozhu Wang, Xichun Wang, Xidi Wang, Xietong Wang, Xifeng Wang, Xifu Wang, Xijun Wang, Xike Wang, Xin Wang, Xin Wei Wang, Xin-Hua Wang, Xin-Liang Wang, Xin-Ming Wang, Xin-Peng Wang, Xin-Qun Wang, Xin-Shang Wang, Xin-Xin Wang, Xin-Yang Wang, Xin-Yue Wang, Xinbo Wang, Xinchang Wang, Xinchao Wang, Xinchen Wang, Xincheng Wang, Xinchun Wang, Xindi Wang, Xindong Wang, Xing Wang, Xing-Huan Wang, Xing-Jin Wang, Xing-Jun Wang, Xing-Lei Wang, Xing-Ping Wang, Xing-Quan Wang, Xingbang Wang, Xingchen Wang, Xingde Wang, Xingguo Wang, Xinghao Wang, Xinghui Wang, Xingjie Wang, Xingjin Wang, Xinglei Wang, Xinglong Wang, Xingqin Wang, Xinguo Wang, Xingxin Wang, Xingxing Wang, Xingye Wang, Xingyu Wang, Xingyue Wang, Xingyun Wang, Xinhui Wang, Xinjing Wang, Xinjun Wang, Xinke Wang, Xinkun Wang, Xinli Wang, Xinlin Wang, Xinlong Wang, Xinmei Wang, Xinqi Wang, Xinquan Wang, Xinran Wang, Xinrong Wang, Xinru Wang, Xinrui Wang, Xinshuai Wang, Xintong Wang, Xinwen Wang, Xinxin Wang, Xinyan Wang, Xinyang Wang, Xinye Wang, Xinyi Wang, Xinying Wang, Xinyu Wang, Xinyue Wang, Xinzhou Wang, Xiong Wang, Xiongjun Wang, Xiru Wang, Xitian Wang, Xiu-Lian Wang, Xiu-Ping Wang, Xiufen Wang, Xiujuan Wang, Xiujun Wang, Xiurong Wang, Xiuwen Wang, Xiuyu Wang, Xiuyuan Hugh Wang, Xixi Wang, Xixiang Wang, Xiyan Wang, Xiyue Wang, Xizhi Wang, Xu Wang, Xu-Hong Wang, Xuan Wang, Xuan-Ren Wang, Xuan-Ying Wang, Xuanwen Wang, Xuanyi Wang, Xubo Wang, Xudong Wang, Xue Wang, Xue-Feng Wang, Xue-Hua Wang, Xue-Lei Wang, Xue-Lian Wang, Xue-Rui Wang, Xue-Yao Wang, Xue-Ying Wang, Xuebin Wang, Xueding Wang, Xuedong Wang, Xuefei Wang, Xuefeng Wang, Xueguo Wang, Xuehao Wang, Xuejie Wang, Xuejing Wang, Xueju Wang, Xuejun Wang, Xuekai Wang, Xuelai Wang, Xuelian Wang, Xuelin Wang, Xuemei Wang, Xuemin Wang, Xueping Wang, Xueqian Wang, Xueqin Wang, Xuesong Wang, Xueting Wang, Xuewei Wang, Xuewen Wang, Xuexiang Wang, Xueyan Wang, Xueyi Wang, Xueying Wang, Xueyun Wang, Xuezhen Wang, Xuezheng Wang, Xufei Wang, Xujing Wang, Xuliang Wang, Xumeng Wang, Xun Wang, Xuping Wang, Xuqiao Wang, Xuru Wang, Xusheng Wang, Xv Wang, Y Alan Wang, Y B Wang, Y H Wang, Y L Wang, Y P Wang, Y Wang, Y Y Wang, Y Z Wang, Y-H Wang, Y-S Wang, Ya Qi Wang, Ya Wang, Ya Xing Wang, Ya-Han Wang, Ya-Jie Wang, Ya-Long Wang, Ya-Nan Wang, Ya-Ping Wang, Ya-Qin Wang, Ya-Zhou Wang, Yachen Wang, Yachun Wang, Yadong Wang, Yafang Wang, Yafen Wang, Yahong Wang, Yahui Wang, Yajie Wang, Yajing Wang, Yajun Wang, Yake Wang, Yakun Wang, Yali Wang, Yalin Wang, Yaling Wang, Yalong Wang, Yan Ming Wang, Yan Wang, Yan-Chao Wang, Yan-Chun Wang, Yan-Feng Wang, Yan-Ge Wang, Yan-Jiang Wang, Yan-Jun Wang, Yan-Ming Wang, Yan-Yang Wang, Yan-Yi Wang, Yan-Zi Wang, Yana Wang, Yanan Wang, Yanbin Wang, Yanbing Wang, Yanchun Wang, Yancun Wang, Yanfang Wang, Yanfei Wang, Yanfeng Wang, Yang Wang, Yang-Yang Wang, Yange Wang, Yanggan Wang, Yangpeng Wang, Yangyang Wang, Yangyufan Wang, Yanhai Wang, Yanhong Wang, Yanhua Wang, Yanhui Wang, Yani Wang, Yanjin Wang, Yanjun Wang, Yankun Wang, Yanlei Wang, Yanli Wang, Yanliang Wang, Yanlin Wang, Yanling Wang, Yanmei Wang, Yanming Wang, Yanni Wang, Yanong Wang, Yanping Wang, Yanqing Wang, Yanru Wang, Yanting Wang, Yanwen Wang, Yanxia Wang, Yanxing Wang, Yanyang Wang, Yanyun Wang, Yanzhe Wang, Yanzhu Wang, Yao Wang, Yaobin Wang, Yaochun Wang, Yaodong Wang, Yaohe Wang, Yaokun Wang, Yaoling Wang, Yaolou Wang, Yaoxian Wang, Yaoxing Wang, Yaozhi Wang, Yapeng Wang, Yaping Wang, Yaqi Wang, Yaqian Wang, Yaqiong Wang, Yaru Wang, Yatao Wang, Yating Wang, Yawei Wang, Yaxian Wang, Yaxin Wang, Yaxiong Wang, Yaxuan Wang, Yayu Wang, Yazhou Wang, Ye Wang, Ye-Ran Wang, Yefu Wang, Yeh-Han Wang, Yehan Wang, Yeming Wang, Yen-Feng Wang, Yen-Sheng Wang, Yeou-Lih Wang, Yeqi Wang, Yezhou Wang, Yi Fan Wang, Yi Lei Wang, Yi Wang, Yi-Cheng Wang, Yi-Chuan Wang, Yi-Ming Wang, Yi-Ni Wang, Yi-Ning Wang, Yi-Shan Wang, Yi-Shiuan Wang, Yi-Shu Wang, Yi-Tao Wang, Yi-Ting Wang, Yi-Wen Wang, Yi-Xin Wang, Yi-Xuan Wang, Yi-Yi Wang, Yi-Ying Wang, Yi-Zhen Wang, Yi-sheng Wang, YiLi Wang, Yian Wang, Yibin Wang, Yibing Wang, Yichen Wang, Yicheng Wang, Yichuan Wang, Yifan Wang, Yifei Wang, Yigang Wang, Yige Wang, Yihan Wang, Yihao Wang, Yihe Wang, Yijin Wang, Yijing Wang, Yijun Wang, Yikang Wang, Yike Wang, Yilin Wang, Yilu Wang, Yimeng Wang, Yiming Wang, Yin Wang, Yin-Hu Wang, Yinan Wang, Yinbo Wang, Yindan Wang, Ying Wang, Ying-Piao Wang, Ying-Wei Wang, Ying-Zi Wang, Yingbo Wang, Yingcheng Wang, Yingchun Wang, Yingfei Wang, Yingge Wang, Yinggui Wang, Yinghui Wang, Yingjie Wang, Yingmei Wang, Yingna Wang, Yingping Wang, Yingqiao Wang, Yingtai Wang, Yingte Wang, Yingwei Wang, Yingwen Wang, Yingxiong Wang, Yingxue Wang, Yingyi Wang, Yingying Wang, Yingzi Wang, Yinhuai Wang, Yining E Wang, Yinong Wang, Yinsheng Wang, Yintao Wang, Yinuo Wang, Yinxiong Wang, Yinyin Wang, Yiou Wang, Yipeng Wang, Yiping Wang, Yiqi Wang, Yiqiao Wang, Yiqin Wang, Yiqing Wang, Yiquan Wang, Yirong Wang, Yiru Wang, Yirui Wang, Yishan Wang, Yishu Wang, Yitao Wang, Yiting Wang, Yiwei Wang, Yiwen Wang, Yixi Wang, Yixian Wang, Yixuan Wang, Yiyan Wang, Yiyi Wang, Yiying Wang, Yizhe Wang, Yong Wang, Yong-Bo Wang, Yong-Gang Wang, Yong-Jie Wang, Yong-Jun Wang, Yong-Tang Wang, Yongbin Wang, Yongdi Wang, Yongfei Wang, Yongfeng Wang, Yonggang Wang, Yonghong Wang, Yongjie Wang, Yongjun Wang, Yongkang Wang, Yongkuan Wang, Yongli Wang, Yongliang Wang, Yonglun Wang, Yongmei Wang, Yongming Wang, Yongni Wang, Yongqiang Wang, Yongqing Wang, Yongrui Wang, Yongsheng Wang, Yongxiang Wang, Yongyi Wang, Yongzhong Wang, You Wang, Youhua Wang, Youji Wang, Youjie Wang, Youli Wang, Youzhao Wang, Youzhi Wang, Yu Qin Wang, Yu Tian Wang, Yu Wang, Yu'e Wang, Yu-Chen Wang, Yu-Fan Wang, Yu-Fen Wang, Yu-Hang Wang, Yu-Hui Wang, Yu-Ping Wang, Yu-Ting Wang, Yu-Wei Wang, Yu-Wen Wang, Yu-Ying Wang, Yu-Zhe Wang, Yu-Zhuo Wang, Yuan Wang, Yuan-Hung Wang, Yuanbo Wang, Yuanfan Wang, Yuanjiang Wang, Yuanli Wang, Yuanqiang Wang, Yuanqing Wang, Yuanyong Wang, Yuanyuan Wang, Yuanzhen Wang, Yubing Wang, Yubo Wang, Yuchen Wang, Yucheng Wang, Yuchuan Wang, Yudong Wang, Yue Wang, Yue-Min Wang, Yue-Nan Wang, YueJiao Wang, Yuebing Wang, Yuecong Wang, Yuegang Wang, Yuehan Wang, Yuehong Wang, Yuehu Wang, Yuehua Wang, Yuelong Wang, Yuemiao Wang, Yueshen Wang, Yueting Wang, Yuewei Wang, Yuexiang Wang, Yuexin Wang, Yueying Wang, Yueze Wang, Yufei Wang, Yufeng Wang, Yugang Wang, Yuh-Hwa Wang, Yuhan Wang, Yuhang Wang, Yuhua Wang, Yuhuai Wang, Yuhuan Wang, Yuhui Wang, Yujia Wang, Yujiao Wang, Yujie Wang, Yujiong Wang, Yulai Wang, Yulei Wang, Yuli Wang, Yuliang Wang, Yulin Wang, Yuling Wang, Yulong Wang, Yumei Wang, Yumeng Wang, Yumin Wang, Yuming Wang, Yun Wang, Yun Yong Wang, Yun-Hui Wang, Yun-Jin Wang, Yun-Xing Wang, Yunbing Wang, Yunce Wang, Yunchao Wang, Yuncong Wang, Yunduan Wang, Yunfang Wang, Yunfei Wang, Yunhan Wang, Yunhe Wang, Yunong Wang, Yunpeng Wang, Yunqiong Wang, Yuntai Wang, Yunzhang Wang, Yunzhe Wang, Yunzhi Wang, Yupeng Wang, Yuping Wang, Yuqi Wang, Yuqian Wang, Yuqiang Wang, Yuqin Wang, Yusha Wang, Yushe Wang, Yusheng Wang, Yutao Wang, Yuting Wang, Yuwei Wang, Yuwen Wang, Yuxiang Wang, Yuxing Wang, Yuxuan Wang, Yuxue Wang, Yuyan Wang, Yuyang Wang, Yuyin Wang, Yuying Wang, Yuyong Wang, Yuzhong Wang, Yuzhou Wang, Yuzhuo Wang, Z P Wang, Z Wang, Z-Y Wang, Zai Wang, Zaihua Wang, Ze Wang, Zechen Wang, Zehao Wang, Zehua Wang, Zekun Wang, Zelin Wang, Zeneng Wang, Zengtao Wang, Zeping Wang, Zexin Wang, Zeying Wang, Zeyu Wang, Zeyuan Wang, Zezhou Wang, Zhan Wang, Zhang Wang, Zhanggui Wang, Zhangshun Wang, Zhangying Wang, Zhanju Wang, Zhao Wang, Zhao-Jun Wang, Zhaobo Wang, Zhaofeng Wang, Zhaofu Wang, Zhaohai Wang, Zhaohui Wang, Zhaojing Wang, Zhaojun Wang, Zhaoming Wang, Zhaoqing Wang, Zhaosong Wang, Zhaotong Wang, Zhaoxi Wang, Zhaoxia Wang, Zhaoyu Wang, Zhe Wang, Zhehai Wang, Zhehao Wang, Zhen Wang, ZhenXue Wang, Zhenbin Wang, Zhenchang Wang, Zhenda Wang, Zhendan Wang, Zhendong Wang, Zheng Wang, Zhengbing Wang, Zhengchun Wang, Zhengdong Wang, Zhenghui Wang, Zhengkun Wang, Zhenglong Wang, Zhenguo Wang, Zhengwei Wang, Zhengxuan Wang, Zhengyang Wang, Zhengyi Wang, Zhengyu Wang, Zhenhua Wang, Zhenning Wang, Zhenqian Wang, Zhenshan Wang, Zhentang Wang, Zhenwei Wang, Zhenxi Wang, Zhenyu Wang, Zhenze Wang, Zhenzhen Wang, Zheyi Wang, Zheyue Wang, Zhezhi Wang, Zhi Wang, Zhi Xiao Wang, Zhi-Gang Wang, Zhi-Guo Wang, Zhi-Hao Wang, Zhi-Hong Wang, Zhi-Hua Wang, Zhi-Jian Wang, Zhi-Long Wang, Zhi-Qin Wang, Zhi-Wei Wang, Zhi-Xiao Wang, Zhi-Xin Wang, Zhibo Wang, Zhichao Wang, Zhicheng Wang, Zhicun Wang, Zhidong Wang, Zhifang Wang, Zhifeng Wang, Zhifu Wang, Zhigang Wang, Zhige Wang, Zhiguo Wang, Zhihao Wang, Zhihong Wang, Zhihua Wang, Zhihui Wang, Zhiji Wang, Zhijian Wang, Zhijie Wang, Zhijun Wang, Zhilun Wang, Zhimei Wang, Zhimin Wang, Zhipeng Wang, Zhiping Wang, Zhiqi Wang, Zhiqian Wang, Zhiqiang Wang, Zhiqing Wang, Zhiren Wang, Zhiruo Wang, Zhisheng Wang, Zhitao Wang, Zhiting Wang, Zhiwu Wang, Zhixia Wang, Zhixiang Wang, Zhixiao Wang, Zhixin Wang, Zhixing Wang, Zhixiong Wang, Zhixiu Wang, Zhiying Wang, Zhiyong Wang, Zhiyou Wang, Zhiyu Wang, Zhiyuan Wang, Zhizheng Wang, Zhizhong Wang, Zhong Wang, Zhong-Hao Wang, Zhong-Hui Wang, Zhong-Ping Wang, Zhong-Yu Wang, ZhongXia Wang, Zhongfang Wang, Zhongjing Wang, Zhongli Wang, Zhonglin Wang, Zhongqun Wang, Zhongsu Wang, Zhongwei Wang, Zhongyi Wang, Zhongyu Wang, Zhongyuan Wang, Zhongzhi Wang, Zhou Wang, Zhou-Ping Wang, Zhoufeng Wang, Zhouguang Wang, Zhuangzhuang Wang, Zhugang Wang, Zhulin Wang, Zhulun Wang, Zhuo Wang, Zhuo-Hui Wang, Zhuo-Jue Wang, Zhuo-Xin Wang, Zhuowei Wang, Zhuoying Wang, Zhuozhong Wang, Zhuqing Wang, Zi Wang, Zi Xuan Wang, Zi-Hao Wang, Zi-Qi Wang, Zi-Yi Wang, Zicheng Wang, Zifeng Wang, Zihan Wang, Ziheng Wang, Zihua Wang, Zihuan Wang, Zijian Wang, Zijie Wang, Zijue Wang, Zijun Wang, Zikang Wang, Zikun Wang, Ziliang Wang, Zilin Wang, Ziling Wang, Zilong Wang, Zining Wang, Ziping Wang, Ziqi Wang, Ziqian Wang, Ziqiang Wang, Ziqing Wang, Ziqiu Wang, Zitao Wang, Ziwei Wang, Zixi Wang, Zixia Wang, Zixian Wang, Zixiang Wang, Zixu Wang, Zixuan Wang, Ziyi Wang, Ziying Wang, Ziyu Wang, Ziyun Wang, Zongbao Wang, Zonggui Wang, Zongji Wang, Zongkui Wang, Zongqi Wang, Zongwei Wang, Zou Wang, Zulong Wang, Zumin Wang, Zun Wang, Zunxian Wang, Zuo Wang, Zuoheng Wang, Zuoyan Wang, Zusen Wang
articles
Yan Chi, Le Wang, Yuanyuan Liu +8 more · 2014 · Atherosclerosis · Elsevier · added 2026-04-24
ATP binding cassette transporter A1 (ABCA1) is a member of the ATP-binding cassette transporter family. It plays an essential role in mediating the efflux of excess cholesterol. It is known that perox Show more
ATP binding cassette transporter A1 (ABCA1) is a member of the ATP-binding cassette transporter family. It plays an essential role in mediating the efflux of excess cholesterol. It is known that peroxisome proliferator-activated receptor gamma (PPARγ) promoted ABCA1 expression. We previously found 7-ketocholesteryl-9-carboxynonanoate (oxLig-1) upregulated ABCA1 partially through CD36 mediated signals. In the present study, we intended to test if PPARγ signally is involved in the upregulation mediated by oxLig-1. First, we docked oxLig-1 and the ligand-binding domain (LBD) of PPARγ by using AutoDock 3.05 and subsequently confirmed the binding by ELISA assay. Western blotting analyses showed that oxLig-1 induces liver X receptor alpha (LXRα), PPARγ and consequently ABCA1 expression. Furthermore, oxLig-1 significantly enhanced ApoA-I-mediated cholesterol efflux. Pretreatment with an inhibitor for PPARγ (GW9662) or/and LXRα (GGPP) attenuated oxLig-1-induced ABCA1 expression. Under PPARγ knockdown by using PPARγ-shRNA, oxLig-1-induced ABCA1 expression and cholesterol efflux in THP-1 macrophages was blocked by 62% and 25% respectively. These observations suggest that oxLig-1 is a novel PPARγ agonist, promoting ApoA-I-mediated cholesterol efflux from THP-1 macrophages by increasing ABCA1 expression via induction of PPARγ. Show less
no PDF DOI: 10.1016/j.atherosclerosis.2014.01.052
NR1H3
Xiao-long Lin, Xing-Lan He, Jun-Fa Zeng +4 more · 2014 · DNA and cell biology · added 2026-04-24
FGF21, a member of the fibroblast growth factor superfamily, is an important endogenous regulator of systemic glucose and lipid metabolism. Elevated serum FGF21 levels have been reported in subjects w Show more
FGF21, a member of the fibroblast growth factor superfamily, is an important endogenous regulator of systemic glucose and lipid metabolism. Elevated serum FGF21 levels have been reported in subjects with coronary heart disease and carotid artery plaques. However, whether FGF21 is associated with atherosclerotic diseases remains unclear. In this study, the effects of FGF21 on cholesterol efflux in THP1 macrophage-derived foam cells and the underlying mechanisms were investigated. THP1 macrophage-derived foam cells were incubated with 0, 25, 50, 100, 200, and 400 ng/mL of FGF21 for varying time periods (0, 6, 12, and 24 h). Cholesterol efflux onto apoA-1 was assessed by high-performance liquid chromatography assays, while change in ABCA1 expression was analyzed by western blot and real-time quantitative PCR. Incubation was performed with the ERK1/2-specific inhibitor PD98059, PPARγ-specific inhibitor GW9662, and LXRα siRNA. Our results show that FGF21 promotes cholesterol efflux and ABCA1 expression in THP1 macrophage-derived foam cells in a dose- and time-dependent manner. In addition, inhibition of ERK1/2 or PPARγ, or knockdown of LXRα attenuated FGF21-mediated promotion of ABCA1 expression and cholesterol efflux. These results demonstrate that FGF21 can promote cholesterol efflux by upregulating ABCA1 through the ERK1/2-PPARγ-LXRα pathway in THP1 macrophage-derived foam cells. Show less
no PDF DOI: 10.1089/dna.2013.2290
NR1H3
Jing-Min Wang, Dong Wang, Yu-Yan Tan +2 more · 2014 · Biochemical and biophysical research communications · Elsevier · added 2026-04-24
Cholesterosis is a disease of cholesterol metabolism characterized by the presence of excessive lipid droplets in the cytoplasm. These lipid droplets are mainly composed of cholesterol esters derived Show more
Cholesterosis is a disease of cholesterol metabolism characterized by the presence of excessive lipid droplets in the cytoplasm. These lipid droplets are mainly composed of cholesterol esters derived from free cholesterol. The removal of excess cholesterol from gallbladder epithelial cells (GBECs) is very important for the maintenance of intracellular cholesterol homeostasis and the preservation of gallbladder function. Several lines of evidence have indicated that the activation of either peroxisome proliferator-activated receptor gamma (PPARγ) or liver X receptor α (LXRα) relates to cholesterol efflux. While pioglitazone can regulate the activation of PPARγ, 22(R)-hydroxycholesterol can activate LXRα and is a metabolic intermediate in the biosynthesis of steroid hormones. However, the effect of 22(R)-hydroxycholesterol in combination with pioglitazone on cholesterosis of the gallbladder is unclear. GBECs were treated with pioglitazone, 22(R)-hydroxycholesterol or PPARγ siRNA followed by Western blot analysis for ATP-binding cassette transporter A1 (ABCA1), PPARγ and LXRα. Cholesterol efflux to apoA-I was determined, and Oil Red O staining was performed to monitor variations in lipid levels in treated GBECs. Our data showed that 22(R)-hydroxycholesterol can modestly up-regulate LXRα while simultaneously increasing ABCA1 by 56%. The combination of 22(R)-hydroxycholesterol and pioglitazone resulted in a 3.64-fold increase in ABCA1 expression and a high rate of cholesterol efflux. Oil Red O staining showed an obvious reduction in the lipid droplets associated with cholesterosis in GBECs. In conclusion, the present findings indicate that the anti-lipid deposition action of 22(R)-hydroxycholesterol combined with pioglitazone involves the activation of the PPARγ-LXRα-ABCA1 pathway, increased ABCA1 expression and the efflux of cholesterol from GBECs. Thus, 22(R)-hydroxycholesterol synergistically combined with pioglitazone to produce a remarkable effect on lipid deposition in cholesterosis GBECs. Show less
no PDF DOI: 10.1016/j.bbrc.2014.03.130
NR1H3
Hongxia Yang, Shijie Zheng, Yiguo Qiu +5 more · 2014 · Investigative ophthalmology & visual science · added 2026-04-24
To investigate whether a synthetic LXR agonist TO901317 (TO90) ameliorates ocular inflammation in a mouse model of experimental autoimmune uveitis (EAU) and to explore its underlying mechanism. EAU wa Show more
To investigate whether a synthetic LXR agonist TO901317 (TO90) ameliorates ocular inflammation in a mouse model of experimental autoimmune uveitis (EAU) and to explore its underlying mechanism. EAU was induced with subcutaneous injection of IRBP161-180 peptide (SGIPYIISYLHPGNTILHVD) in B10.RIII mice. TO90 (50 mg/kg/d) or vehicle was administrated orally for successive 16 days or 8 days as prevention or effector phase, respectively. The severity of EAU was evaluated with clinical and histological scores. The levels of LXRs, NF-κB subunit p65, and an LXR target gene ABCA1 in the retina were detected with real-time PCR and Western blotting. The expressions of proinflammatory genes, including TNF-α, IL-1β, IL-6, MCP-1, IFN-γ, and IL-17, were detected by real-time PCR. IRBP-specific lymphocyte proliferation was detected by MTT. Intracellular IFN-γ and IL-17 in CD4(+) T cells were measured by flow cytometry. We found both LXRα and LXRβ were expressed in mouse retina. After administering TO90 orally to B10.RIII mice, the expression of LXRα but not LXRβ was upregulated in the naïve mice. Compared with naïve mice, LXRα expression was increased in vehicle and TO90-treated EAU mice, but the LXRβ expression was unchanged. The protein level of ABCA1 was enhanced in TO90-treated naïve and EAU mice but was unchanged in vehicle-treated EAU mice, suggesting activation of LXRα by TO90 is ligand dependent. TO90-mediated activation of LXRα improved the clinical and morphological scores in EAU mice. Meanwhile, activation of LXRα decreased the expressions of proinflammatory cytokines, including TNF-α, IL-1β, IL-6, MCP-1, IFN-γ, and IL-17 in the retina. TO90 treatment inhibited IRBP-specific immune responses. The proportions of Th1 and Th17 expressing IFN-γ and IL-17 were reduced in TO90-treated EAU mice in both prevention and effector phases. Furthermore, TO90 significantly downregulated the expressions of an NF-κB subunit p65 at the protein and mRNA levels. TO90 activates LXRα and potently attenuates ocular inflammation in EAU. Alleviation of ocular inflammation could partially result from inhibition of the NF-κB signaling pathway. TO90 reduces IFN-γ and IL-17 expression in both prevention and treatment scenarios. Our data suggest that the LXR agonist may become a novel class of therapeutic agent for autoimmune uveitis. Show less
no PDF DOI: 10.1167/iovs.13-13323
NR1H3
Jia-Yi Zhao, Yan-wei Hu, Shu-Fen Li +8 more · 2014 · Lipids in health and disease · BioMed Central · added 2026-04-24
Apolipoprotein M (apoM), as a novel apolipoprotein which is mainly expressed in liver and kidney tissues, is associated with development and progression of atherosclerosis and diabetes. Our group have Show more
Apolipoprotein M (apoM), as a novel apolipoprotein which is mainly expressed in liver and kidney tissues, is associated with development and progression of atherosclerosis and diabetes. Our group have recently shown that Dihydrocapsaicin(DHC)can significantly decrease atherosclerotic plaque formation in apoE-/- mice. However, the effect and possible mechanism of DHC on apoM expression remain unclear. HepG2 cells were treated with 0 μM, 25 μM, 50 μM and 100 μM DHC for 24 h or were treated with 100 μM DHC for 0, 6, 12, and 24 h, respectively. The mRNA levels and protein levels were measured by real-time quantitative PCR and western blot analysis, respectively. We found that DHC markedly decreased expression of apoM at both mRNA and protein level in HepG2 cells in a dose-dependent and time-dependent manner. Expression of Foxa2 was decreased while expression of LXRα was increased by DHC treatment in HepG2 cells. In addittion, overexpression of Foxa2 markedly compensated the inhibition effect induced by DHC on apoM expression. LXRα small interfering RNA significantly abolished the inhibition effect which induced by DHC on apoM expression. The liver of C57BL/6 mice treated with DHC had significantly lower expression of apoM. Furthermore, the liver had lower expression of Foxa2 while had higher expression of LXRα. DHC could down-regulate apoM expression through inhibiting Foxa2 expression and enhancing LXRα expression in HepG2 cells. Show less
no PDF DOI: 10.1186/1476-511X-13-50
NR1H3
Xiang-liang Xu, En-bo Wang, Nian-hui Cui · 2014 · Beijing da xue xue bao. Yi xue ban = Journal of Peking University. Health sciences · added 2026-04-24
To get the stem cells from the young permanent tooth apical papillae, and observe the osteogenic differentiation of the cells after cultured with acellular dermal matrix (ADM). Young permanent tooth a Show more
To get the stem cells from the young permanent tooth apical papillae, and observe the osteogenic differentiation of the cells after cultured with acellular dermal matrix (ADM). Young permanent tooth apical papillae were obtained by the oral surgeon. The cells from the apical papillae were isolated, cultured and analyzed through a flow cytometer. The cells in the experimental group were induced both osteogenic and adipogenic differentiation. The cells were not induced in the control group.Both groups were evaluated by staining and real-time polymerase chain reaction (real-time PCR) to examine the quantity of RNAs in the experimental group. The cells from apical papillae were also cultured with ADM. These cells were also induced both osteogenic and adipogenic differentiation in the experimental group, and not induced in the control group. The measures of staining and real-time PCR were also carried out. The cells from the apical papillae proliferated in a rapid rate. Of which 70.3% in cultures were positive for Stro-1, and 96% positive for CD105 according to flow cytometric analysis. After induction, the RNA level related to osteogenic and adipogenic differentiation expressed higher in the experimental group than those of the control group without induction obviously, such as osteocalcin (OCN), bone sialoprotein (BSP), liver X-recepter α (LXRα), lipoprotein lipase(LPL), peroxisome proliferator activated receptor γ (PPAR-γ), and scavenger receptor class B type 1(SR-B1). The cells cultured with ADM also had a fast proliferation, and grew attached to ADM. After induction, the RNA level of OCN and BSP had a higher expression than the control group (P > 0.05), and LPL also expressed higher (P < 0.05). The study approved that there were a big amount of stem cells in the young permanent tooth apical papilla obtained by oral surgery, which had significant osteogenic potential. The cells still proliferated well when they were cultured with ADM as a kind of collagen skelecton. The results showed that ADM could be performed as a base to support the stem cells to survive the environment, and it also could play a role in osteogenic differentiation of stem cells from apical papilla. Show less
no PDF
NR1H3
Lulu Wang, Xianping Huang, Su Hu +3 more · 2014 · Chinese medical journal · added 2026-04-24
Statin therapy has affected glucose homoeostasis of type 2 diabetes patients, which could be related with bile acids metabolism. Whether bile acid metabolism and the expression of farnesoid X receptor Show more
Statin therapy has affected glucose homoeostasis of type 2 diabetes patients, which could be related with bile acids metabolism. Whether bile acid metabolism and the expression of farnesoid X receptor (FXR), liver X receptor-α (LXR-α) and sterol regulatory element-binding protein (Srebp)-1c is regulated by hyperglycemia, or whether simvastatin therapy led to higher glucose is related with down-regulated expression of FXR in diabetic rats remained unclear. Forty male Wistar rats were randomly divided into four groups: normal control rats, insulin resistance rats, diabetic model rats, and the late simvastatin induced diabetic rats. Normal control rats were fed with standard diet, others were fed with high-fat diet. Diabetic model rats were induced by a single intraperitoneal injection of streptozotocin (STZ). The late simvastatin induced diabetic rats started simvastatin administration after STZ induced diabetic model rats. Characteristics of fasting blood glucose (FPG), lipid files and total bile acids (TBAs) were measured and the oral glucose tolerance test (OGTT) was performed after overnight fasting at the eighth weekend. RNA and protein levels of FXR, LXR-α and Srebp-1c were tested by Western blotting and reverse transcription polymerase chain reaction (RT-PCR). The insulin resistance rats showed higher glucose, lipid files and lower expression of FXR compared with normal control rats (P > 0.05). The diabetic model rats showed significantly higher glucose, lipid files, TBA and lower expression of FXR compared with insulin resistance rats (P < 0.05). The late simvastatin induced diabetic rats displayed higher glucose and TBA and lower expression of FXR compared with diabetic model rats (P < 0.05). Changes in bile acid homeostasis, including the alterations of bile acid levels and bile acid receptors, are either a cause or a consequence of the metabolic disturbances observed during diabetic models. Statin therapy induced hyperglycemia may be related with FXR, SHP, LXR-α and Srebp-1 pathways. Show less
no PDF
NR1H3
Qixue Wang, Xingzhe Ma, Yuanli Chen +8 more · 2014 · The Biochemical journal · added 2026-04-24
LXR (liver X receptor) is a ligand-activated transcription factor and plays an important role in regulation of lipid homoeostasis and inflammation. Several studies indicate that LXR inhibits IFN-γ (in Show more
LXR (liver X receptor) is a ligand-activated transcription factor and plays an important role in regulation of lipid homoeostasis and inflammation. Several studies indicate that LXR inhibits IFN-γ (interferon γ)-induced biological responses; however, the influence of LXR on IFN-γ expression has not been fully elucidated. In the present study, we investigated the effects of LXR activation on IFN-γ expression at different levels. At the molecular level, we surprisingly observed that LXR ligand (T0901317) induced macrophage and T-cell IFN-γ protein expression which was associated with increased mRNA and secreted protein levels in culture medium. In contrast, selective inhibition of LXRα and/or LXRβ expression by siRNA reduced IFN-γ expression. Promoter analysis defined the multiple LXREs (LXR-responsive elements) in the proximal region of the IFN-γ promoter. EMSAs and ChIP indicated that LXR activation enhanced the binding of LXR protein to these LXREs. In vivo, T0901317 increased wild-type mouse serum IFN-γ levels and IFN-γ expression in the lung and lymph nodes. Functionally, we observed that administration of T0901317 to wild-type mice increased rates of survival and being tumour-free, and inhibited tumour growth when the animals were inoculated with LLC1 carcinoma. In contrast, these protective effects were substantially attenuated in IFN-γ-knockout (IFN-γ-/-) mice, suggesting that the induction of IFN-γ production plays a critical role in T0901317-inhibited tumour growth. Taken together, the results of the present study show that IFN-γ is another molecular target of LXR activation, and it suggests a new mechanism by which LXR inhibits tumour growth. Show less
no PDF DOI: 10.1042/BJ20131442
NR1H3
Huan Wang, Yan Liu, Ling Zhu +6 more · 2014 · International journal of molecular medicine · added 2026-04-24
Estrogen has pleiotropic effects on the cardiovascular diseases, yet the underlying mechanisms remain incompletely understood. Cholesterol efflux is a key mechanism through which to prevent foam cell Show more
Estrogen has pleiotropic effects on the cardiovascular diseases, yet the underlying mechanisms remain incompletely understood. Cholesterol efflux is a key mechanism through which to prevent foam cell formation and the development of atherosclerosis. Recent studies highlight the role of vascular smooth muscle cell (VSMC)-derived foam cells in atherogenesis. However, it remains unclear whether estrogen promotes cholesterol efflux from VSMCs and inhibits VSMC-derived foam cell formation. In the present study, we demonstrated that 17β-estradiol (E2) markedly enhanced cholesterol efflux to apolipoprotein (apo)A-1 and high-density lipoprotein (HDL) and attenuated oxidized low-density lipoprotein (ox-LDL) induced cholesteryl ester accumulation in VSMCs, which was associated with an increase in the expression of ATP-binding cassette transporters ABCA1 and ABCG1. The upregulation of ABCA1 and ABCG1 expression by E2 resulted from liver X receptor (LXR)α activation, which was confirmed by the prevention of the expression of ABCA1 and ABCG1 after inhibition of LXRα with a pharmacological inhibitor or small interfering RNA (siRNA). Furthermore, E2 increased LXRα, ABCA1 and ABCG1 expression in VSMCs via the estrogen receptor (ER), and the involvement of ERβ was confirmed by the use of selective ERα or ERβ antagonists (MPP and PHTPP) and agonists (PPT and DPN). These findings suggest that E2 promotes cholesterol efflux from VSMCs and reduces VSMC-derived foam cell formation via ERβ- and LXRα-dependent upregulation of ABCA1 and ABCG1 and provide novel insights into the anti-atherogenic properties of estrogen. Show less
no PDF DOI: 10.3892/ijmm.2014.1619
NR1H3
Ni Li, Yanni Xu, Tingting Feng +4 more · 2014 · Journal of biomolecular screening · SAGE Publications · added 2026-04-24
Liver X receptor α (LXRα) plays an important role in reverse cholesterol transport (RCT), and activation of LXRα could reduce atherosclerosis. In the present study, we developed a screening method to Show more
Liver X receptor α (LXRα) plays an important role in reverse cholesterol transport (RCT), and activation of LXRα could reduce atherosclerosis. In the present study, we developed a screening method to identify new potential LXRα agonists using an LXRα-GAL4 chimera reporter assay. A novel analogue of N,N-disubstituted 2,8-diazaspiro[4.5]decane, IMB-151, was identified as an LXRα agonist by using this method. IMB-151 showed a significant activation effect on LXRα, with an EC50 value of 1.47 µM. IMB-151 also increased the expression of ATP-binding cassette transporter A1 (ABCA1) and G1 (ABCG1) in RAW264.7 macrophages. The upregulating effects of IMB-151 on ABCA1 and ABCG1 markedly decreased when coincubated with geranylgeranyl pyrophosphate (GGPP) ammonium salt or LXRα small interfering RNA (siRNA). Our data indicated that the upregulation of ABCA1 and ABCG1 by IMB-151 depended on activation of LXRα. Moreover, IMB-151 significantly reduced cellular lipid accumulation and increased cholesterol efflux in RAW264.7 macrophages. Interestingly, IMB-151 slightly increased sterol response element binding protein 1c (SREBP-1c) protein expression levels in HepG2 cells compared with TO901317, and this indicated that IMB-151 might have less lipogenesis side effect in vivo. These results suggested that IMB-151 was identified as a selective agonist for LXRα by using a screening method and could be used as a potential antiatherosclerotic lead compound in the future. Show less
no PDF DOI: 10.1177/1087057113516004
NR1H3
Monika Patel, Xiaoxin X Wang, Lilia Magomedova +10 more · 2014 · Diabetologia · Springer · added 2026-04-24
Liver X receptors (LXRs) α and β are nuclear hormone receptors that are widely expressed in the kidney. They promote cholesterol efflux from cells and inhibit inflammatory responses by regulating gene Show more
Liver X receptors (LXRs) α and β are nuclear hormone receptors that are widely expressed in the kidney. They promote cholesterol efflux from cells and inhibit inflammatory responses by regulating gene transcription. Here, we hypothesised (1) that LXR deficiency would promote renal decline in a mouse model of diabetes by accelerating intraglomerular cholesterol accumulation and, conversely, (2) that LXR agonism would attenuate renal decline in diabetes. Diabetes was induced with streptozotocin (STZ) and maintained for 14 weeks in Lxrα/β (+/+) (Lxrα, also known as Nr1h3; Lxrβ, also known as Nr1h2) and Lxrα/β (-/-) mice. In addition, STZ-injected DBA/2J mice were treated with vehicle or the LXR agonist N,N-dimethyl-hydroxycholenamide (DMHCA) (80 mg/kg daily) for 10 weeks. To determine the role of cholesterol in diabetic nephropathy (DN), mice were placed on a Western diet after hyperglycaemia developed. Even in the absence of diabetes, Lxrα/β (-/-) mice exhibited a tenfold increase in the albumin:creatinine ratio and a 40-fold increase in glomerular lipid accumulation compared with Lxrα/β (+/+) mice. When challenged with diabetes, Lxrα/β (-/-) mice showed accelerated mesangial matrix expansion and glomerular lipid accumulation, with upregulation of inflammatory and oxidative stress markers. In the DN-sensitive STZ DBA/2J mouse model, DMHCA treatment significantly decreased albumin and nephrin excretion (by 50% each), glomerular lipids and plasma triacylglycerol (by 70%) and cholesterol (by 48%); it also decreased kidney inflammatory and oxidative stress markers compared with vehicle-treated mice. These data support the idea that LXR plays an important role in the normal and diabetic kidney, while showing that LXR, through its inhibitory effect on inflammation and cholesterol accumulation in glomeruli, could also be a novel therapeutic target for DN. Show less
no PDF DOI: 10.1007/s00125-013-3095-6
NR1H3
Xiaoyan Zhang, Jia Liu, Wen Su +7 more · 2014 · Journal of diabetes · Blackwell Publishing · added 2026-04-24
Liver X receptors (LXRs) including LXRα and LXRβ are members of the nuclear hormone receptor superfamily of ligand activated transcription factors, which serve as lipid sensors to regulate expression Show more
Liver X receptors (LXRs) including LXRα and LXRβ are members of the nuclear hormone receptor superfamily of ligand activated transcription factors, which serve as lipid sensors to regulate expression of genes controlling many aspects of cholesterol and fatty acid metabolism. The liver is the central organ in controlling lipid metabolism. In the present study, we aimed at elucidating the role of LXR activation in hepatic fatty acid homeostasis. We treated C57BL/6 mice with a synthetic non-selective LXR agonist TO901317. Fatty acid profile of lipid esters in the livers was analyzed by gas-liquid chromatography. Real-time polymerase chain reaction (PCR) and western blot were used to determine the expression of SREBP1c and SCD1 in TO901317-treated livers and HepG2 cells. Oral administration of TO901317 resulted in increased fatty acid desaturation in the liver, with concomitant increase in hepatic stearoyl CoA desaturase-1 (SCD1) expression. TO901317-induced SCD1 expression was observed in LXRβ-/- mice, but not in LXRα-/- mice. Furthermore, TO901317 significantly increased expression of sterol regulatory element-binding protein 1c (SREBP1c), the deficiency of which almost completely abolished the induction of SCD1 by TO901317. This drug induced both SREBP1c and SCD1 expression in HepG2 cells. Overexpression of SREBP1c resulted in a significant increase in SCD1 promoter activity and expression. Taken together, the present studies demonstrate that pan-LXR activation increases hepatic fatty acid desaturation via the induction of SCD1 expression in an LXRα-dependent and SREBP1c-mediated manner. Show less
no PDF DOI: 10.1111/1753-0407.12081
NR1H3
Yong Zhang, Lifeng Wang, Jiachao Zhang +6 more · 2014 · European journal of nutrition · Springer · added 2026-04-24
To evaluate the preventive and therapeutic effects of Lactobacilluscasei Zhang on impaired glucose tolerance (IGT) by using fructose-induced hyperinsulinemia rats. Rats were fed 25 % fructose solution Show more
To evaluate the preventive and therapeutic effects of Lactobacilluscasei Zhang on impaired glucose tolerance (IGT) by using fructose-induced hyperinsulinemia rats. Rats were fed 25 % fructose solution for hyperinsulinemia with L.casei Zhang for prevention or therapy. Serum levels of insulin, glucagon-like peptide-2 (GLP-2), osteocalcin, malondialdehyde (MDA), total intestinal bile acids and hepatic glycogen contents were determined by assay kits. The major bacteria from feces and liver expression of adiponectin receptor 2 (AdipoR2), liver X receptor-α (LXR-α), peroxisome proliferator-activated receptor gamma (PPAR-γ) and vitamin K epoxide reductase complex subunit 1 mRNA were assessed by RT-PCR. Pancreas injury was evaluated by histological analysis. Lactobacilluscasei Zhang significantly increased numbers of Lactobacillus and Bifidobacterium and decreased Clostridium in the intestine (p < 0.01). Meanwhile, liver glycogen contents were significantly decreased (p < 0.05). In preventive group, accompanied by significantly lower insulin and GLP-2 levels (p < 0.05), L.casei Zhang prevented rats from an increase in oral glucose tolerance area under curve (AUC) which was significant in hyperinsulinemia group (p < 0.05). In therapeutic group, L.casei Zhang administration possessed improved glucose tolerance (p < 0.05), which were associated with increased osteocalcin level (p < 0.01), improved intestinal bile acids secretion (p = 0.060), decreased serum MDA levels (p < 0.05) and upregulation of LXR-α, PPAR-γ and AdipoR2 gene expression, as well as an increase in Bacteroides fragilis (p < 0.05). Lactobacilluscasei Zhang administration exert both preventive and ameliorative effect on oral glucose tolerance AUC in IGT rats but may be via different mechanisms. L.casei Zhang could prevent rats from increased AUC through GLP-2 lowering, while the ameliorative effect in high-fructose-fed post-adolescent rats may be via B. fragilis enriched vitamin K2-dependent osteocalcin mechanism in which AdipoR2, LXR-α and PPAR-γ signaling were involved. Show less
no PDF DOI: 10.1007/s00394-013-0519-5
NR1H3
Zhenda Wang, Jia Hu, Ge Li +6 more · 2014 · Autophagy · added 2026-04-24
Autophagy is a multistep process that involves the degradation and digestion of intracellular components by the lysosome. It has been proved that many core autophagy-related molecules participate in t Show more
Autophagy is a multistep process that involves the degradation and digestion of intracellular components by the lysosome. It has been proved that many core autophagy-related molecules participate in this event. However, new component proteins that regulate autophagy are still being discovered. At present, we report PHF23 (PHD finger protein 23) with a PHD-like zinc finger domain that can negatively regulate autophagy. Data from experiments indicated that the overexpression of PHF23 impaired autophagy, as characterized by decreased levels of LC3B-II and weakened degradation of endogenous and exogenous autophagic substrates. Conversely, knockdown of PHF23 resulted in opposite effects. Molecular mechanism studies suggested that PHF23 interacts with LRSAM1, which is an E3 ligase key for ubiquitin-dependent autophagy against invading bacteria. PHF23 promotes the ubiquitination and proteasome degradation of LRSAM1. We also show that the PHD finger of PHF23 is a functional domain needed for the interaction with LRSAM1. Altogether, our results indicate that PHF23 is a negative regulator associated in autophagy via the LRSAM1 signaling pathway. The physical and functional connection between the PHF23 and LRSAM1 needs further investigation. Show less
no PDF DOI: 10.4161/auto.36439
PIK3C3
Fengliang Wang, Yafang Yang, Ziyi Fu +6 more · 2014 · Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie · Elsevier · added 2026-04-24
Breast cancer has been considered to be a multifactorial disease with a wide array of well-characterized gene mutations and chromosomal abnormalities. However, it is becoming evident that the onset or Show more
Breast cancer has been considered to be a multifactorial disease with a wide array of well-characterized gene mutations and chromosomal abnormalities. However, it is becoming evident that the onset or development of breast cancer also depends on epigenetic factors, although the mechanisms have not been fully elucidated. We performed a genome-wide analysis of DNA methylation of breast carcinomatous tissues and paired normal tissues to examine the differences in methylation between them. Methylation-specific polymerase chain reaction (MSP) was used to validate the hypermethylated genes screened out by DNA methylation microarray. We found that hypomethylation and hypermethylation occurred in 2753 and 1795 genes, respectively, in breast carcinomatous tissues. Meanwhile, gene ontology analysis and ingenuity pathway analysis revealed the function and pathway of several genes whose methylation status was altered in breast carcinomatous tissues. In addition, we investigated the promoter methylation status of four genes in breast carcinomatous tissue and paired normal tissues (n=30) by MSP. Promoter hypermethylation of CRABP1, HOXB13, IFNGR2, and PIK3C3 was found in 37% (11/30), 23% (7/30), 17% (5/30), and 2% (2/30) of the carcinomas, respectively. Mutation of these four important genes was critical to many types of cancer. Our results suggest that DNA methylation mechanisms may be involved in regulating the occurrence and development of breast cancer. Show less
no PDF DOI: 10.1016/j.biopha.2014.07.014
PIK3C3
Pei Wang, Tian-Ying Xu, Kai Wei +6 more · 2014 · Autophagy · added 2026-04-24
Autophagy, a highly conserved process conferring cytoprotection against stress, contributes to the progression of cerebral ischemia. β-arrestins are multifunctional proteins that mediate receptor dese Show more
Autophagy, a highly conserved process conferring cytoprotection against stress, contributes to the progression of cerebral ischemia. β-arrestins are multifunctional proteins that mediate receptor desensitization and serve as important signaling scaffolds involved in numerous physiopathological processes. Here, we show that both ARRB1 (arrestin, β 1) and ARRB2 (arrestin, β 2) were upregulated by cerebral ischemic stress. Knockout of Arrb1, but not Arrb2, aggravated the mortality, brain infarction, and neurological deficit in a mouse model of cerebral ischemia. Accordingly, Arrb1-deficient neurons exhibited enhanced cell injury upon oxygen-glucose deprivation (OGD), an in vitro model of ischemia. Deletion of Arrb1 did not affect the cerebral ischemia-induced inflammation, oxidative stress, and nicotinamide phosphoribosyltransferase upregulation, but markedly suppressed autophagy and induced neuronal apoptosis/necrosis in vivo and in vitro. Additionally, we found that ARRB1 interacted with BECN1/Beclin 1 and PIK3C3/Vps34, 2 major components of the BECN1 autophagic core complex, under the OGD condition but not normal conditions in neurons. Finally, deletion of Arrb1 impaired the interaction between BECN1 and PIK3C3, which is a critical event for autophagosome formation upon ischemic stress, and markedly reduced the kinase activity of PIK3C3. These findings reveal a neuroprotective role for ARRB1, in the context of cerebral ischemia, centered on the regulation of BECN1-dependent autophagosome formation. Show less
no PDF DOI: 10.4161/auto.29203
PIK3C3
Pengyan Xia, Shuo Wang, Guanling Huang +4 more · 2014 · Cell research · Nature · added 2026-04-24
WASH (Wiskott-Aldrich syndrome protein (WASP) and SCAR homolog) was identified to function in endosomal sorting via Arp2/3 activation. We previously demonstrated that WASH is a new interactor of BECN1 Show more
WASH (Wiskott-Aldrich syndrome protein (WASP) and SCAR homolog) was identified to function in endosomal sorting via Arp2/3 activation. We previously demonstrated that WASH is a new interactor of BECN1 and present in the BECN1-PIK3C3 complex with AMBRA1. The AMBRA1-DDB1-CUL4A complex is an E3 ligase for K63-linked ubiquitination of BECN1, which is required for starvation-induced autophagy. WASH suppresses autophagy by inhibition of BECN1 ubiquitination. However, how AMBRA1 is regulated during autophagy remains elusive. Here, we found that RNF2 associates with AMBRA1 to act as an E3 ligase to ubiquitinate AMBRA1 via K48 linkage. RNF2 mediates ubiquitination of AMBRA1 at lysine 45. Notably, RNF2 deficiency enhances autophagy induction. Upon autophagy induction, RNF2 potentiates AMBRA1 degradation with the help of WASH. WASH deficiency impairs the association of RNF2 with AMBRA1 to impede AMBRA1 degradation. Our findings reveal another novel layer of regulation of autophagy through WASH recruitment of RNF2 for AMBRA1 degradation leading to downregulation of autophagy. Show less
no PDF DOI: 10.1038/cr.2014.85
PIK3C3
G A Doyle, C L Schwebel, S E Ruiz +7 more · 2014 · Neuroscience · Elsevier · added 2026-04-24
Compared to DBA/2J (D2), C57BL/6J (B6) inbred mice exhibit strong morphine preference when tested using a two-bottle choice drinking paradigm. A morphine preference quantitative trait locus (QTL), Mop Show more
Compared to DBA/2J (D2), C57BL/6J (B6) inbred mice exhibit strong morphine preference when tested using a two-bottle choice drinking paradigm. A morphine preference quantitative trait locus (QTL), Mop2, was originally mapped to proximal chromosome (Chr) 10 using a B6xD2 F2 intercross population, confirmed with reciprocal congenic strains and fine mapped with recombinant congenic strains. These efforts identified a ∼ 10-Million base pair (Mbp) interval, underlying Mop2, containing 35 genes. To further reduce the interval, mice from the D2.B6-Mop2-P1 congenic strain were backcrossed to parental D2 mice and two new recombinant strains of interest were generated: D2.B6-Mop2-P1.pD.dB and D2.B6-Mop2-P1.pD.dD. Results obtained from testing these strains in the two-bottle choice drinking paradigm suggest that the gene(s) responsible for the Mop2 QTL is one or more of 22 remaining within the newly defined interval (∼ 7.6 Mbp) which includes Oprm1 and several other genes related to opioid pharmacology. Real-time qRT-PCR analysis of Oprm1 and opioid-related genes Rgs17, Ppp1r14c, Vip, and Iyd revealed both between-strain and within-strain expression differences in comparisons of saline- and morphine-treated B6 and D2 mice. Analysis of Rgs17 protein levels also revealed both between-strain and within-strain differences in comparisons of saline- and morphine-treated B6 and D2 mice. Results suggest that the Mop2 QTL represents the combined influence of multiple genetic variants on morphine preference in these two strains. Relative contributions of each variant remain to be determined. Show less
no PDF DOI: 10.1016/j.neuroscience.2014.07.020
RGS17
Yanchao Jiang, Haibo Wang, David Culp +6 more · 2014 · Investigative ophthalmology & visual science · added 2026-04-24
To determine whether knockdown of Müller cell-derived VEGFA-splice variant, VEGF164, which is upregulated in the rat retinopathy of prematurity (ROP) model, safely inhibits intravitreal neovasculariza Show more
To determine whether knockdown of Müller cell-derived VEGFA-splice variant, VEGF164, which is upregulated in the rat retinopathy of prematurity (ROP) model, safely inhibits intravitreal neovascularization (IVNV). Short hairpin RNAs for VEGF164 (VEGF164.shRNAs) or luciferase.shRNA control were cloned into lentivectors with CD44 promoters that specifically target Müller cells. Knockdown efficiency, off-target effects, and specificity were tested in HEK reporter cell lines that expressed green fluorescent protein (GFP)-tagged VEGF164 or VEGF120 with flow cytometry or in rat Müller cells (rMC-1) by real-time PCR. In the rat oxygen-induced retinopathy (OIR) ROP model, pups received 1 μL subretinal lentivector-driven luciferase.shRNA, VEGFA.shRNA, or VEGF164.shRNA at postnatal day 8 (P8). Analyses at P18 and P25 included: IVNV and avascular retina (AVA); retinal and serum VEGF (ELISA); density of phosphorylated VEGFR2 (p-VEGFR2) in lectin-labeled retinal endothelial cells (ECs; immunohistochemistry); TUNEL staining and thickness of inner nuclear (INL) and outer nuclear layers (ONL) in retinal cryosections; and pup weight gain. In HEK reporter and in rMC-1 cells and in comparison to lucifferase.shRNA, VEGFA.shRNA reduced both VEGF120 and VEGF164, but VEGF164.shRNA only reduced VEGF164 and not VEGF120. Compared with luciferase.shRNA, VEGFA.shRNA and VEGF164.shRNA reduced retinal VEGF and IVNV without affecting AVA at P18 and P25. At P25, VEGF164.shRNA more effectively maintained IVNV inhibition than VEGFA.shRNA. VEGFA.shRNA and VEGF164.shRNA reduced pVEGFR2 in retinal ECs at P18, but VEGFA.shRNA increased it at P25. VEGFA.shRNA increased TUNEL+ cells at P18 and decreased ONL thickness at P18 and P25. VEGFA.shRNA and VEGF164.shRNA did not affect pup weight gain and serum VEGF. Short hairpin RNA to Müller cell VEGF164 maintained long-term inhibition of IVNV and limited cell death compared with shRNA to VEGFA. Show less
no PDF DOI: 10.1167/iovs.13-13755
RMC1
Jin-Gyoung Jung, Alexander Stoeck, Bin Guan +5 more · 2014 · PLoS genetics · PLOS · added 2026-04-24
The Notch3 signaling pathway is thought to play a critical role in cancer development, as evidenced by the Notch3 amplification and rearrangement observed in human cancers. However, the molecular mech Show more
The Notch3 signaling pathway is thought to play a critical role in cancer development, as evidenced by the Notch3 amplification and rearrangement observed in human cancers. However, the molecular mechanism by which Notch3 signaling contributes to tumorigenesis is largely unknown. In an effort to identify the molecular modulators of the Notch3 signaling pathway, we screened for Notch3-intracellular domain (N3-ICD) interacting proteins using a human proteome microarray. Pathway analysis of the Notch3 interactome demonstrated that ubiquitin C was the molecular hub of the top functional network, suggesting the involvement of ubiquitination in modulating Notch3 signaling. Thereby, we focused on functional characterization of an E3 ubiquitin-protein ligase, WWP2, a top candidate in the Notch3 interactome list. Co-immunoprecipitation experiments showed that WWP2 interacted with N3-ICD but not with intracellular domains from other Notch receptors. Wild-type WWP2 but not ligase-deficient mutant WWP2 increases mono-ubiquitination of the membrane-tethered Notch3 fragment, therefore attenuating Notch3 pathway activity in cancer cells and leading to cell cycle arrest. The mono-ubiquitination by WWP2 may target an endosomal/lysosomal degradation fate for Notch3 as suggested by the fact that the process could be suppressed by the endosomal/lysosomal inhibitor. Analysis of The Cancer Genome Atlas dataset showed that the majority of ovarian carcinomas harbored homozygous or heterozygous deletions in WWP2 locus, and there was an inverse correlation in the expression levels between WWP2 and Notch3 in ovarian carcinomas. Furthermore, ectopic expression of WWP2 decreased tumor development in a mouse xenograft model and suppressed the Notch3-induced phenotypes including increase in cancer stem cell-like cell population and platinum resistance. Taken together, our results provide evidence that WWP2 serves as a tumor suppressor by negatively regulating Notch3 signaling in ovarian cancer. Show less
no PDF DOI: 10.1371/journal.pgen.1004751
WWP2
Lan Fang, Ling Zhang, Wei Wei +6 more · 2014 · Molecular cell · Elsevier · added 2026-04-24
Sox2 is a key factor for maintaining embryonic stem cell (ESS) pluripotency, but little is known about its posttranslational regulation. Here we present evidence that the precise level of Sox2 protein Show more
Sox2 is a key factor for maintaining embryonic stem cell (ESS) pluripotency, but little is known about its posttranslational regulation. Here we present evidence that the precise level of Sox2 proteins in ESCs is regulated by a balanced methylation and phosphorylation switch. Set7 monomethylates Sox2 at K119, which inhibits Sox2 transcriptional activity and induces Sox2 ubiquitination and degradation. The E3 ligase WWP2 specifically interacts with K119-methylated Sox2 through its HECT domain to promote Sox2 ubiquitination. In contrast, AKT1 phosphorylates Sox2 at T118 and stabilizes Sox2 by antagonizing K119me by Set7 and vice versa. In mouse ESCs, AKT1 activity toward Sox2 is greater than that of Set7, leading to Sox2 stabilization and ESC maintenance. In early development, increased Set7 expression correlates with Sox2 downregulation and appropriate differentiation. Our study highlights the importance of a Sox2 methylation-phosphorylation switch in determining ESC fate. Show less
no PDF DOI: 10.1016/j.molcel.2014.06.018
WWP2
Xinlong Luo, Beibei Wang, Fan Tang +4 more · 2014 · Biochemical and biophysical research communications · Elsevier · added 2026-04-24
SRG3 plays essential roles both in early mouse embryogenesis and in extra-embryonic vascular development. As one of the core components of the SWI/SNF-like BAF complex, SRG3 serves as the scaffold pro Show more
SRG3 plays essential roles both in early mouse embryogenesis and in extra-embryonic vascular development. As one of the core components of the SWI/SNF-like BAF complex, SRG3 serves as the scaffold protein and its protein level controls the stability of the BAF complex, which controls diverse physiological processes through transcriptional regulation. However, little is known about how the protein level of SRG3 is regulated in mammalian cells. Previously, we identified a murine ubiquitin ligase (Wwp2) and demonstrated that it interacts with pluripotency-associated key transcription factor Oct4 and RNA polymerase II large subunit Rpb1, promoting their ubiquitination and degradation. Here, we report that Wwp2 acts as a ubiquitin ligase of SRG3. Our results show that Wwp2 and SRG3 form protein complexes and co-localize in the nucleus in mammalian cells. The interaction is mediated through the WW domain of Wwp2 and the PPPY motif of SRG3, respectively. Importantly, Wwp2 promotes ubiquitination and degradation of SRG3 through the ubiquitin-proteasome system. The expression of a catalytically inactive mutant of Wwp2 abolishes SRG3 ubiquitination. Collectively, our study opens up a new avenue to understand how the protein level of SRG3 is regulated in mammalian cells. Show less
no PDF DOI: 10.1016/j.bbrc.2013.12.089
WWP2
Lynn Htet Htet Aung, Rui-Xing Yin, Dong-Feng Wu +3 more · 2014 · Journal of cellular and molecular medicine · Blackwell Publishing · added 2026-04-24
The single nucleotide polymorphisms (SNPs) in the BUD13 homolog (BUD13) and zinc finger protein 259 (ZNF259) genes have been associated with one or more serum lipid traits in the European populations. Show more
The single nucleotide polymorphisms (SNPs) in the BUD13 homolog (BUD13) and zinc finger protein 259 (ZNF259) genes have been associated with one or more serum lipid traits in the European populations. However, little is known about such association in the Chinese populations. Our objectives were to determine the association of the BUD13/ZNF259 SNPs and their haplotypes with hypercholesterolaemia (HCH)/hypertriglyceridaemia (HTG) and to identify the possible gene-gene interactions among these SNPs. Genotyping of 6 SNPs was performed in 634 hyperlipidaemic and 547 normolipidaemic participants. The ZNF259 rs2075290, ZNF259 rs964184 and BUD13 rs10790162 SNPs were significantly associated with serum lipid levels in both HCH and non-HCH populations (P < 0.008-0.001). On single locus analysis, only BUD13 rs10790162 was associated with HCH (OR: 2.23, 95% CI: 1.05, 4.75, P = 0.015). The G-G-A-A-C-C haplotype, carrying rs964184-G-allele, was associated with increased risk of HCH (OR: 1.35, 95% CI: 1.10, 1.66, P = 0.005) and HTG (OR: 1.75, 95% CI: 1.39, 2.21, P = 0.000). The A-C-G-G-C-C and A-C-A-G-T-C haplotypes, carrying rs964184-C-allele, were associated with reduced risk of HCH (OR: 0.77, 95% CI: 0.61, 0.99, P = 0.039 and OR: 0.66, 95% CI: 0.47, 0.94, P = 0.021 respectively). On multifactor dimensionality reduction analyses, the two- to three-locus models showed a significant association with HCH and HTG (P < 0.01-0.001). The BUD13/ZNF259 SNPs, which were significant in the European populations, are also replicable in the Southern Chinese population. Moreover, inter-locus interactions may exist among these SNPs. However, further functional studies are required to clarify how these SNPs and genes actually affect the serum lipid levels. Show less
no PDF DOI: 10.1111/jcmm.12291
ZPR1
Lynn Htet Htet Aung, Rui-Xing Yin, Dong-Feng Wu +3 more · 2014 · International journal of medical sciences · added 2026-04-24
Little is known about the association of ZNF259 rs2075290 single nucleotide polymorphism (SNP) and serum lipid levels in the Chinese population. This study aimed to detect the association of ZNF259 rs Show more
Little is known about the association of ZNF259 rs2075290 single nucleotide polymorphism (SNP) and serum lipid levels in the Chinese population. This study aimed to detect the association of ZNF259 rs2075290 SNP and environmental factors with serum lipid levels between males and females in the Mulao and Han populations. Genotyping of ZNF259 rs2075290 SNP was performed in 788 of Mulao and 778 of Han participants using polymerase chain reaction and restriction fragment length polymorphism. The genotype frequencies were significantly different between Mulao and Han populations (AA, 50.1% Vs 58.9%; AG, 42.3% Vs 35.7%; GG, 7.6% Vs 5.4%, P = 0.002) and between Han males and females (AA, 64.5% Vs 55.2%; AG, 28.3% Vs 40.6%; GG, 7.2% Vs 4.2%, P = 0.001). Serum levels of triglyceride (TG) in Mulao males, and total cholesterol (TC), TG and low-density lipoprotein cholesterol (LDL-C) in Mulao females were different between the AA and AG/GG genotypes (P < 0.05-0.001). Serum TC, LDL-C and apolipoprotein (Apo) A1 levels in Han males, and TG and ApoB levels and ApoA1/ApoB ratio in Han females were different between the AA and AG/GG genotypes (P < 0.05-0.001). An interaction between ZNF259 rs2075290 polymorphism and male gender on serum TC, LDL-C, and ApoA1 levels was noted in Han population (P < 0.05-0.01) but not in Mulao's. The subjects with AG/GG genotype in Mulao males and females and Han females have less favorable lipid profiles than those with AA genotype. In contrast, the subjects with AG/GG genotype in Han males have more favorable lipid profiles than those with AA genotype. These findings suggest that the association between ZNF259 rs2075290 SNP and serum lipid levels might have ethnic- and/or sex-specificity. Show less
no PDF DOI: 10.7150/ijms.8489
ZPR1
Scott K Sherman, Jennifer C Carr, Donghong Wang +3 more · 2013 · Surgery · Elsevier · added 2026-04-24
Ligands binding the somatostatin receptor type 2 (SSTR2) are useful for imaging and treatment of neuroendocrine tumors (NETs), but not all tumors express high levels of these receptors. The aim of thi Show more
Ligands binding the somatostatin receptor type 2 (SSTR2) are useful for imaging and treatment of neuroendocrine tumors (NETs), but not all tumors express high levels of these receptors. The aim of this study was to evaluate gene expression of new therapeutic targets in NETs relative to SSTR2. RNA was extracted from 103 primary small bowel and pancreatic NETs, matched normal tissue, and 123 metastases. Expression of 12 candidate genes was measured by quantitative polymerase chain reaction normalized to internal controls; candidate gene expression was compared with SSTR2. Relative to normal tissue, primary NET expression of SSTR2, GPR98, BRS3, GIPR, GRM1, and OPRK1 were increased by 3, 8, 13, 13, 17, and 20-fold, respectively. Similar changes were found in metastases. Although most candidate genes showed lesser absolute expressions than SSTR2, absolute GIPR expression was closest to SSTR2 (mean dCT 3.6 vs. 2.7, P = .01). Absolute OPRK1 and OXTR expression varied greatly by primary tumor type and was close to SSTR2 in small bowel NETs but not pancreatic NETs. Compared with the current treatment standard SSTR2, GIPR has only somewhat lesser absolute gene expression in tumor tissue but much lesser expression in normal tissue, making it a promising new target for NET imaging and therapy. Show less
📄 PDF DOI: 10.1016/j.surg.2013.04.052
GIPR
Mohamed Bessat, Giselle Knudsen, Alma L Burlingame +1 more · 2013 · PloS one · PLOS · added 2026-04-24
The anaphase-promoting complex/cyclosome (APC/C) is a multi-subunit E3 ubiquitin ligase that initiates chromosome segregation and mitotic exit by targeting critical cell-cycle regulators for proteolyt Show more
The anaphase-promoting complex/cyclosome (APC/C) is a multi-subunit E3 ubiquitin ligase that initiates chromosome segregation and mitotic exit by targeting critical cell-cycle regulators for proteolytic destruction. Previously, seven APC/C subunit homologues were identified in the genome of Trypanosoma brucei. In the present study, we tested five of them in yeast complementation studies and found none of them capable of complementing the yeast mutants lacking the corresponding subunits, suggesting significant discrepancies between the two APC/C's. Subunit homologues of mitotic checkpoint complex (MCC) have not yet been identified in T. brucei, raising the possibility that a MCC-APC/C complex equivalent may not exist in T. brucei. We performed tandem affinity purification of the protein complex containing a APC1 fusion protein expressed in the cells enriched in different phases of the cell cycle of procyclic form T. brucei, and compared their protein profiles using LC-MS/MS analyses. The seven putative APC/C subunits were identified in the protein complex throughout the cell cycle together with three additional proteins designated the associated proteins (AP) AP1, AP2 and AP3. Abundance of the 10 proteins remained relatively unchanged throughout the cell cycle, suggesting that they are the core subunits of APC/C. AP1 turned out to be a homologue of APC4. An RNAi knockdown of APC4 and AP3 showed no detectable cellular phenotype, whereas an AP2 knockdown enriched the cells in G2/M phase. The AP2-depleted cells showed stabilized mitotic cyclin B. An accumulation of poly-ubiquitinated cyclin B was indicated in the cells treated with the proteasome inhibitor MG132, demonstrating the involvement of proteasome in degrading poly-ubiquitinated cyclin B. In all, a 10-subunit APC/C machinery with a conserved function is identified in T. brucei without linking to a MCC-like complex, thus indicating a unique T. brucei APC/C. Show less
📄 PDF DOI: 10.1371/journal.pone.0059258
ANAPC4
Yanbing Wang, Yingnan Hou, Hongya Gu +4 more · 2013 · Journal of integrative plant biology · Blackwell Publishing · added 2026-04-24
Anaphase-promoting complex/cyclosome (APC/C), a multisubunit E3 ligase, plays a critical role in cell cycle control, but the functional characterization of each subunit has not yet been completed. To Show more
Anaphase-promoting complex/cyclosome (APC/C), a multisubunit E3 ligase, plays a critical role in cell cycle control, but the functional characterization of each subunit has not yet been completed. To investigate the function of APC1 in Arabidopsis, we analyzed four mutant alleles of APC1, and found that mutation in APC1 resulted in significantly reduced plant fertility, accumulation of cyclin B, and disrupted auxin distribution in embryos. The three mutant alleles apc1-1, apc1-2 and apc1-3 shared variable defects in female gametogenesis including degradation, abnormal nuclear number, and disrupted polarity of nuclei in the embryo sac as well as in embryogenesis, in which embryos were arrested at multiple stages. All of these defects are similar to those previously identified in apc4. The mutant apc1-4, in which the T-DNA was inserted after the transmembrane domain at the C-terminus, showed much more severe phenotypes; that is, most of the ovules were arrested at the one-nucleate female gametophyte stage (stage FG1). In the apc1 apc4 double mutants, the fertility was further reduced by one-third in apc1-1/+ apc4-1/+, and in some cases no ovules even survived in siliques of apc1-4/+ apc4-1/+. Our data thus suggest that APC1, an essential component of APC/C, plays a synergistic role with APC4 both in female gametogenesis and in embryogenesis. Show less
no PDF DOI: 10.1111/jipb.12018
ANAPC4
Yuan-Yuan Zhang, Rui-Feng Duan, Wen-Yu Cui +5 more · 2013 · Zhongguo ying yong sheng li xue za zhi = Zhongguo yingyong shenglixue zazhi = Chinese journal of applied physiology · added 2026-04-24
High altitude pulmonary edema (HAPE), a life-threatening disease, has no biological markers used for the routine prevention, diagnosis and treatment. The aim of this study was to identify serum protei Show more
High altitude pulmonary edema (HAPE), a life-threatening disease, has no biological markers used for the routine prevention, diagnosis and treatment. The aim of this study was to identify serum proteins differentially expressed in patients with HAPE for discovering essential biomarkers. A complete serum proteomic analysis was performed on 10 HAPE patients and on 10 high altitude and 11 sea level healthy people as control using two-dimensional gel electrophoresis, followed by matrix-assisted laser desorption/ionization mass spectrometry and peptide mass fingerprinting. Finally, two most significantly changed proteins were validated by enzyme-linked immunosorbent assay (ELISA). Eight protein spots stained with differential intensity, respresenting 5 distinct proteins were identified in patients compared with healthy controls through analysis of these composite gels. Among them, four proteins, namely alpha 1-antitrypsin(alpha1-AT), Haptoglobin(Hp), apolipoprotein A-1 (apoA-1) and Complement C3 increased remarkably, while one protein, apolipoprotein A-IV (apoA-IV) decreased significantly. The variation of alpha1-AT and Haptoglobin, as detected by ELISA, was consistent with the results from proteomic analysis. It is well known that Hp, alpha1-AT and complement C3 are associated with inflammation and apoA-1 and apoA-IV play important roles in lipid absorption, transport and metabolism. Therefore, the significant expression changes of Hp, alpha1-AT and complement C3 and apoA-1 and apoA-IV between HAPE patients and their corresponding healthy controls highlight the role of inflammatory response system and lipid metabolism system in the pathophysiology of HAPE. Show less
no PDF
APOA4
Fei Wang, Kevin J Pearson, W Sean DavidsoN +1 more · 2013 · Physiology & behavior · Elsevier · added 2026-04-24
Rodent apoA-IV is expressed predominantly in small intestine and also expressed to a small extent in liver and hypothalamus. ApoA-IV has been shown to inhibit food intake in rats when injected central Show more
Rodent apoA-IV is expressed predominantly in small intestine and also expressed to a small extent in liver and hypothalamus. ApoA-IV has been shown to inhibit food intake in rats when injected centrally. In the current study, we hypothesize that a specific sequence within rat apoA-IV is responsible for mediating the anorectic effect. We use a bacterial expression system to generate truncation mutants (Δ249-371, Δ117-371 and Δ1-61) of rat apoA-IV and assess the ability of various regions of the molecule to inhibit food intake. The results indicate that a responsible sequence exists within the N-terminal 61 amino acids of rat apoA-IV. Synthetic peptides (1-30 EVTSDQVANVMWDYFTQLSNNAKEAVEQLQ, 1-15 EVTSDQVANVMWDYF and 17-30 QLSNNAKEAVEQLQ) were used to specify the region in between residues 1 and 30. A 14-mer peptide (17-30) encompassing this sequence was capable of reducing food intake in a dose-dependent manner whereas a peptide designed on a more C-terminal region (211-232) of apoA-IV (QEKLNHQMEGLAFQMKKNAEEL) failed to exhibit the dose-dependent anorectic effect. The isolation of this sequence provides a valuable tool for future work directed at identifying apoA-IV binding proteins and is a key step for exploring the potential of therapeutic manipulation of food intake via this pathway. Show less
📄 PDF DOI: 10.1016/j.physbeh.2013.07.010
APOA4
Jiabei Li, Mingbao Song, Dehui Qian +6 more · 2013 · Clinical and investigative medicine. Medecine clinique et experimentale · added 2026-04-24
The purpose of this study was to evaluate the relationship between apolipoprotein A-IV (apoA-IV) plasma concentrations and acute coronary syndrome (ACS). Plasma apoA-IV concentrations were measured in Show more
The purpose of this study was to evaluate the relationship between apolipoprotein A-IV (apoA-IV) plasma concentrations and acute coronary syndrome (ACS). Plasma apoA-IV concentrations were measured in 115 patients with different types of ACS and in 68 gender- and age-matched control subjects using Enzyme-Linked Immunosorbent Assay (ELISA) kits. The clinical data were collected by an internist, who was blinded to plasma apoA-IV concentrations. Plasma apoA-IV levels in ACS patients were significantly decreased compared to the levels in control subjects (437.0±157.5 μg/mL vs. 590.2±183.7 μg/mL, P<0.001). An statistically significant decreasing trend of plasma apoA-IV levels from the control subjects, to patients with unstable angina pectoris (UAP) (457.3±152.9 μg/mL), to patients with acute myocardial infarction (AMI) (311.7±127.8 μg/mL), was observed. Moreover, plasma apoA-IV level was negatively associated with New York Heart Association (NYHA) functional class. NYHA class II (467.2±142.1 μg/mL, P<0.001) and class III/IV (368.1±170.8 μg/mL, P<0.001) patients had statistically decreased levels of plasma apoA-IV when compared to the control subjects. A stepwise multivariate regression analysis identified types of ACS, NYHA classes, and plasma fibrinogen levels as the most important determinants of plasma apoA-IV levels in ACS patients. Low plasma apoA-IV levels are associated with ACS, and plasma apoA-IV levels may be a potential treatment target for ACS patients. Show less
no PDF DOI: 10.25011/cim.v36i4.19954
APOA4