👤 Zhan Wang

🔍 Search 📋 Browse 🏷️ Tags ❤️ Favourites ➕ Add 🧪 BiometalDB 🧬 Extraction
4397
Articles
2763
Name variants
Also published as: Junli Wang, Xindi Wang, Junpeng Wang, Tingyu Wang, Guoqiang Wang, Yuxuan Wang, Hanzhi Wang, Zhi-Long Wang, Shanshan Wang, Wenfei Wang, Dengbin Wang, Yen-Sheng Wang, Chuanxin Wang, Zeyu Wang, Beibei Wang, Taicheng Wang, Xingguo Wang, Z P Wang, Yue-Min Wang, Chenghua Wang, Xianqiang Wang, Congrong Wang, Yanhai Wang, Du Wang, Xianzhe Wang, Zuoheng Wang, Yongyi Wang, Zhihui Wang, Yanhua Wang, Limeng Wang, H J Wang, Pei-Jian Wang, Yana Wang, Congrui Wang, Larry Wang, Yu-Zhuo Wang, Sihua Wang, Wanchun Wang, Jialin Wang, Xinying Wang, Shuguang Wang, Yinhuai Wang, Xiaobin Wang, Yuying Wang, Hebo Wang, Leli Wang, Jiayu Wang, Zhaojun Wang, Hai Wang, Si Wang, Re-Hua Wang, Xuping Wang, Bo Wang, Shubao Wang, Songjiao Wang, Hongjia Wang, Victoria Wang, Ling Wang, Jianjie Wang, Haining Wang, Dali Wang, Ji-Yang Wang, Cheng Wang, Weifan Wang, Yuanqiang Wang, Zhixiao Wang, Yaxian Wang, Zhigang Wang, Haochen Wang, Jia-Ying Wang, Shichao Wang, Ruosu Wang, N Wang, Haixing Wang, Guiqun Wang, Zhiting Wang, Dan Wang, Wangxia Wang, Jing-Long Wang, Yaqian Wang, Yafang Wang, Xing-Jun Wang, Dapeng Wang, Zhongyuan Wang, Junsheng Wang, Zhaohai Wang, He-Ping Wang, Minmin Wang, Wenzhou Wang, Zhaohui Wang, Yanfang Wang, Pengtao Wang, Leran Wang, Qianwen Wang, Hongkun Wang, Sa Wang, Y Alan Wang, Liyan Wang, Jou-Kou Wang, Mingda Wang, Chenfei Wang, Yuehan Wang, Simeng Wang, Yuhua Wang, Ruibin Wang, Haibo Wang, Ni Wang, Guoxiu Wang, Zhuangzhuang Wang, Yajie Wang, Zhixiang Wang, Sangui Wang, Xiantao Wang, Yan-Yang Wang, Mengjun Wang, Ruling Wang, Peihe Wang, Miao Wang, Zaihua Wang, Jun-Jie Wang, Mengyao Wang, Zhiyu Wang, Changzhen Wang, Xijun Wang, Chengjian Wang, Yiyi Wang, Mo Wang, Xiaolun Wang, Danan Wang, Fanchang Wang, Zilin Wang, Fanhua Wang, Supeng Perry Wang, Gavin Wang, Yi-Ying Wang, Yani Wang, Zhuowei Wang, Weiwei Wang, Haifeng Wang, Yi-Shiuan Wang, Yan-Chao Wang, Xiaotong Wang, Jia-Qi Wang, Yongliang Wang, Yongming Wang, Fengchong Wang, Jianyong Wang, Zeping Wang, Huaquan Wang, Xiaojia Wang, Tao Wang, Tianjun Wang, Siying Wang, Zhenze Wang, Zhijian Wang, Li Wang, Heming Wang, Jingtong Wang, Xuefei Wang, Yingqiao Wang, Xiao Qun Wang, Chun-Chieh Wang, Shuang-Xi Wang, Laiyuan Wang, Zhaoming Wang, Yinggui Wang, Qi-Jia Wang, Wen-Yan Wang, Mingming Wang, Peipei Wang, Chien-Hsun Wang, Qiuhong Wang, Monica Wang, Lexin Wang, Xiufen Wang, Yuehua Wang, Pingfeng Wang, Caiyan Wang, Weijie Wang, Yigang Wang, Jieyan Wang, Huiquan Wang, Chunsheng Wang, Yunhe Wang, Changtu Wang, Qingliang Wang, Guanghua Wang, Yongbin Wang, Zhaobo Wang, Minghui Wang, Junshi Wang, Jingyu Wang, Longsheng Wang, Fen Wang, Xianshu Wang, Jianwu Wang, Jun-Zhuo Wang, Zhixing Wang, Lei Wang, Yiyan Wang, Jinglin Wang, Jinhe Wang, Enhua Wang, Yuecong Wang, Xueying Wang, Jennifer T Wang, Xin-Hua Wang, Shijie Wang, Chun-Xia Wang, Yuanjiang Wang, Xiaojun Wang, Shunjun Wang, Chun-Juan Wang, M Wang, Jinfei Wang, Jinghuan Wang, Xuru Wang, Xiao-Lan Wang, Yu-Chen Wang, Zhi-Guo Wang, Luya Wang, Shuwei Wang, Pingchuan Wang, Qifan Wang, Xing-Quan Wang, Weiding Wang, Xuebin Wang, Yaling Wang, Chenyin Wang, Allen Wang, Liyuan Wang, Rong-Rong Wang, Wusan Wang, Wayseen Wang, Qianru Wang, Yi-Xin Wang, Hailin Wang, Yu-Hang Wang, Xuesong Wang, Haojie Wang, Wanxia Wang, Mengwen Wang, Hanping Wang, Yuhang Wang, Lueli Wang, Xinchang Wang, Oliver Wang, Shuge Wang, Jianhao Wang, Chong Wang, Kui Wang, Litao Wang, Zining Wang, Ming-Yang Wang, Hongxia Wang, Mingyi Wang, Hai Bo Wang, Bingnan Wang, Hongqian Wang, Jisheng Wang, Jiakun Wang, Maoju Wang, Xiaoqiu Wang, Dongyi Wang, Hai Yang Wang, Pengju Wang, Xiaofeng Wang, Huming Wang, Jian'an Wang, Qianrong Wang, Xiaowei Wang, Xiangkun Wang, Da Wang, Hongying Wang, Changying Wang, Changyu Wang, Xiaoqin Wang, Zhenxi Wang, Qiaoqiao Wang, Yu Tian Wang, Yupeng Wang, Xinli Wang, YueJiao Wang, Jian-chun Wang, Pengchao Wang, Xiao-Juan Wang, Siqing Wang, C Z Wang, Pengbo Wang, Baoli Wang, Yu-Zhe Wang, Gui-Qi Wang, Dazhi Wang, Yanwen Wang, Xingqin Wang, Shijin Wang, Wenming Wang, Fanxiong Wang, Tiansong Wang, Shuzhe Wang, Jie Wang, Jinling Wang, Yunfang Wang, Luyao Wang, Cun-Yu Wang, Zikang Wang, Quan-Ming Wang, Yingying Wang, Chia-Chuan Wang, Xintong Wang, Jufeng Wang, Xuejun Wang, Xiao-Qian Wang, Yijin Wang, Meng Yu Wang, Tianyi Wang, Chia-Lin Wang, Zhuo-Jue Wang, Yaohe Wang, Rong Wang, Hao-Hua Wang, Yong-Jun Wang, Xubo Wang, Dalong Wang, Yan-Ge Wang, Erika Y Wang, Ruixian Wang, Jin-Liang Wang, Shicung Wang, Saifei Wang, Jintao Wang, Zhenzhen Wang, Jiawei Wang, Beilei Wang, Huabo Wang, Huiyu Wang, Hongtao Wang, Chengjun Wang, Guo-Du Wang, Taoxia Wang, Zitao Wang, Jingwen Wang, Yibin Wang, Long Wang, Xinjing Wang, Qunzhi Wang, Liangliang Wang, Bangchen Wang, Yu-Fen Wang, Shibin Wang, Congcong Wang, Xiong Wang, Zhiren Wang, Xiaozhu Wang, Hong-Xia Wang, Qingyong Wang, Tianying Wang, Tammy C Wang, Huijie Wang, Tiansheng Wang, Mengzhao Wang, Jianshu Wang, Xinlong Wang, Benzhong Wang, Zhipeng Wang, Kaijie Wang, Xiaomin Wang, Peijun Wang, Zhiqiang Wang, Jundong Wang, Zheng Wang, Yueze Wang, Sujuan Wang, Qing-Yun Wang, Xiaoqing Wang, Zongqi Wang, Zhicun Wang, Fudi Wang, Seok Mui Wang, Wanbing Wang, Kejun Wang, Nanping Wang, Mingyang Wang, Wenxia Wang, Yaru Wang, Zikun Wang, Shidong Wang, Bei Bei Wang, Yu-Hui Wang, Rui Wang, Yige Wang, Tongxin Wang, Xiaohua Wang, Changjing Wang, Xingjin Wang, Bingjie Wang, Shaoyu Wang, Hui-Hui Wang, Zhenyu Wang, Baoying Wang, Yang-Yang Wang, Shi-Yao Wang, Lifei Wang, Fangfang Wang, Zhimei Wang, Kunpeng Wang, Binglong Wang, Daijun Wang, Qinghang Wang, Zi Wang, Shushu Wang, QingDong Wang, Qing K Wang, Fuhua Wang, Yanni Wang, Jianle Wang, Wenyan Wang, Jinning Wang, Ziqi Wang, Wei-Qi Wang, Yaolou Wang, Haoming Wang, Jian-Wei Wang, Tian Wang, Peixi Wang, Iris X Wang, Tongxia Wang, Mei-Xia Wang, Haiying Wang, Tielin Wang, Hongze Wang, Chung-Hsi Wang, Peiyao Wang, Linli Wang, Guanru Wang, Yuzhong Wang, Yunhan Wang, Jianan Wang, Menglong Wang, Yingxue Wang, Jiayi Wang, Dingxiang Wang, Ting Wang, Fenglin Wang, Jianqun Wang, Ran Wang, Kuan Hong Wang, Liusong Wang, Wen-Der Wang, Yixuan Wang, Feng Wang, Kaicen Wang, Eryao Wang, Yulei Wang, Huaibing Wang, Zhongzhi Wang, Jinrong Wang, Sujie Wang, Xiaozhong Wang, Xiao-Pei Wang, Li-Na Wang, H X Wang, Linjie Wang, Zhaosong Wang, Yafen Wang, Chuan-Wen Wang, Xiaoning Wang, Li-Xin Wang, Silas L Wang, Baocheng Wang, Hongyi Wang, Zhi-Xiao Wang, Shengjie Wang, Zhi-Hao Wang, Yaokun Wang, Shao-Kang Wang, Qunxian Wang, Jianghui Wang, Zhao Wang, Di Wang, Jianzhi Wang, Ruijing Wang, Ling Jie Wang, Qingshi Wang, Jianye Wang, Yuqiang Wang, Kangling Wang, Anxin Wang, Shengli Wang, Zhulin Wang, Hua-Wei Wang, Yiwen Wang, Yang Wang, Hanqi Wang, Changwei Wang, Honglei Wang, Yi Lei Wang, Wenkang Wang, Junjie Wang, Yazhou Wang, Peng-Cheng Wang, Chenzi Wang, Anqi Wang, Yuemiao Wang, Xuelin Wang, Rujie Wang, Dongyan Wang, Yuxue Wang, Wengong Wang, Qigui Wang, Junqing Wang, Ruhan Wang, Xinye Wang, Huihui Wang, Gengsheng Wang, Mark Wang, Zhidong Wang, Mengmeng Wang, Yuwen Wang, Liang Wang, Huaxiang Wang, Fangjun Wang, Huixia Wang, Haijiao Wang, Hong-Hui Wang, Yi-Shan Wang, Yunchao Wang, Junjun Wang, Binghai Wang, Xinguo Wang, Jun-Sing Wang, Lingzhi Wang, Yuexiang Wang, Hong-Gang Wang, Yen-Feng Wang, Xidi Wang, Jiawen Wang, Liangfu Wang, Lifeng Wang, Shihan Wang, Wentian Wang, Sa A Wang, Lee-Kai Wang, Yu-Wei Wang, Zumin Wang, Shau-Chun Wang, Jianjiao Wang, Tian-Tian Wang, Jiantao Wang, Edward Wang, Jianbo Wang, Qingfeng Wang, Wenran Wang, Xiaolin Wang, Fenghua Wang, Rongjia Wang, Shiqiang Wang, Caixia Wang, Guihu Wang, Xindong Wang, Wenxiu Wang, Xueguo Wang, YiLi Wang, Aizhong Wang, Qiqi Wang, Chengcheng Wang, D Wang, L Wang, Jianhua Wang, Qiuling Wang, Shaolian Wang, Wen-Qing Wang, Wenqing Wang, Yuchuan Wang, Guangdi Wang, Yiquan Wang, Huimei Wang, Genghao Wang, Zun Wang, Miranda C Wang, Annette Wang, Chi-Ping Wang, Hanmin Wang, Zhaoxi Wang, Shifeng Wang, Runze Wang, Mangju Wang, Junjiang Wang, Dong D Wang, Xiu-Ping Wang, Haijiu Wang, Linghuan Wang, Yiying Wang, Renqian Wang, Nana Wang, Xiangdong Wang, Shiyin Wang, Chaoyi Wang, Menghan Wang, Shuyue Wang, Yongmei Wang, Nanbu Wang, Lihua Wang, Hongyue Wang, Jianli Wang, Chunli Wang, Minghua Wang, Junkai Wang, Chenguang Wang, Siyue Wang, Jun Wang, Shu-Song Wang, Bingyan Wang, Qingping Wang, Zhong-Yu Wang, Fei-Fei Wang, Jennifer E Wang, Z-Y Wang, Dongxia Wang, Dang Wang, Zi-Hao Wang, Rihua Wang, Jutao Wang, Yanzhe Wang, Guohao Wang, Liming Wang, Yishu Wang, Xuemin Wang, Xianfeng Wang, Zixu Wang, Jingfan Wang, Guang-Jie Wang, Guixue Wang, Jiaojiao Wang, Yaxin Wang, Haibing Wang, Weizhong Wang, Hairong Wang, Hai-Jun Wang, Mingji Wang, Yongrui Wang, Huizhi Wang, Longfei Wang, Chongmin Wang, Jingyang Wang, Zhong-Ping Wang, Huanhuan Wang, Baisong Wang, Xiaohui Wang, Fengyang Wang, Wanliang Wang, Ziqiang Wang, Chuan Wang, Jeffrey Wang, Ying-Zi Wang, Ziwei Wang, Xian Wang, Hanyu Wang, Qiming Wang, Dedong Wang, Fengying Wang, Xiaoya Wang, Zhenhua Wang, Yanchun Wang, Keming Wang, Zi-Yi Wang, Dezhong Wang, Jingying Wang, Shouli Wang, Lan-lan Wang, Weiyu Wang, Yuhuai Wang, Jun Yi Wang, Wenying Wang, Xue-Feng Wang, Xing-Lei Wang, Yuehong Wang, Pengyu Wang, Yihe Wang, Guodong Wang, Weijian Wang, Wu-Wei Wang, Y Wang, Ruonan Wang, Jianbing Wang, Mian Wang, Dennis Qing Wang, Nannan Wang, Zuo Wang, Christine Wang, Ruixin Wang, Yaxiong Wang, Siwei Wang, Yuanzhen Wang, Wen-Chang Wang, Haijing Wang, X Wang, Melissa T Wang, Haixia Wang, Qianghu Wang, Hongsheng Wang, Xiurong Wang, Shaowei Wang, Shuo Wang, Zengtao Wang, Yun-Xing Wang, Songtao Wang, Mei Wang, Mengyun Wang, Qingming Wang, Ke-Feng Wang, Zhihao Wang, Haoqi Wang, X E Wang, Xin-Shang Wang, Dongmei Wang, Lingli Wang, Huai-Zhou Wang, Hua Wang, Kunzheng Wang, Mao-Xin Wang, Jingzhou Wang, Jiaqi Wang, Xingbang Wang, Wence Wang, Yongdi Wang, Xin-Qun Wang, Guoyi Wang, Jian-Guo Wang, Jiafu Wang, Pin Wang, Libo Wang, Junling Wang, J Z Wang, Haozhou Wang, Jing Wang, Hezhi Wang, T Q Wang, Xi-Hong Wang, Yuanfan Wang, Endi Wang, Hua-Qin Wang, Jeremy Wang, Songping Wang, Suyun Wang, Jiqing Wang, Shu-Ling Wang, Jennifer X Wang, Lily Wang, Yin-Hu Wang, Jen-Chywan Wang, Qingqing Wang, Shuangyuan Wang, Haihong Wang, Luyun Wang, Yake Wang, Ya-Nan Wang, Weicheng Wang, Jianxiang Wang, Zihua Wang, Lin Wang, Fu-Sheng Wang, Zongbao Wang, Tong-Hong Wang, Xianze Wang, Ting-Ting Wang, Haibin Wang, Xin-Yue Wang, Zhi-Gang Wang, Ziying Wang, Shukang Wang, Wen-Jun Wang, Delin Wang, Yating Wang, Xuehao Wang, Yefu Wang, Yi-Ning Wang, Cheng-zhang Wang, Jing J Wang, Xinglong Wang, Yanqing Wang, Tongyao Wang, Dongyang Wang, Deqi Wang, Qiao Wang, Alice Wang, Yunzhi Wang, Dayong Wang, Renxi Wang, Yeh-Han Wang, Mingya Wang, Longxiang Wang, Hualin Wang, Hailei Wang, Ao Wang, Wanyu Wang, Jiale Wang, Qiangcheng Wang, Huishan Wang, Yunqiong Wang, Xudong Wang, Xifu Wang, Wen-Xuan Wang, Dao Wen Wang, Zhi-Wei Wang, Xingchen Wang, Yanyang Wang, Yutao Wang, Huizhen Wang, Hu WANG, Y P Wang, Wen Wang, Qingsong Wang, Baofeng Wang, Ruo-Ran Wang, Yaobin Wang, Changliang Wang, Pintian Wang, Dai Wang, Su-Guo Wang, Ruting Wang, Fengzhen Wang, Qinrong Wang, HuiYue Wang, Baosen Wang, Shuhe Wang, Yifei Wang, Jiun-Ling Wang, Junhui Wang, Guangzhi Wang, Qijia Wang, Yushe Wang, Jinlong Wang, Zhouguang Wang, Huiyao Wang, Shuxin Wang, Yingyi Wang, Jing-Yi Wang, Yongxiang Wang, Zhi Wang, Dehao Wang, Yi-sheng Wang, Jiazhi Wang, Yunfei Wang, Mingjin Wang, Yaozhi Wang, Jinyu Wang, Jinmeng Wang, LiLi Wang, Shuai Wang, Yan Wang, Jun Kit Wang, Cui Wang, Dong-Jie Wang, Yangyang Wang, Xiangguo Wang, Runuo Wang, Ruimin Wang, Pengpu Wang, Nuan Wang, Guangyan Wang, Xin-Liang Wang, Minxiu Wang, Ruifang Wang, Hui Wang, Hongda Wang, Xiyan Wang, Jinxia Wang, Xinchen Wang, Haihua Wang, Delong Wang, Yayu Wang, Xue-Hua Wang, Xin-Peng Wang, Changqian Wang, Bei Wang, Ya-Han Wang, Chih-Liang Wang, P N Wang, Xiaoqian Wang, Xianshi Wang, Zhiruo Wang, Xueding Wang, Renxiao Wang, Yi-Ming Wang, Tianqi Wang, Ledan Wang, Rongyun Wang, Gan Wang, Qinqin Wang, Yuxiang Wang, Feimiao Wang, Mengyuan Wang, Chaofan Wang, Linshuang Wang, Yanhui Wang, Zhenglong Wang, Zongkui Wang, Zhenwei Wang, Xiyue Wang, Yi Fan Wang, Xiao-Ai Wang, Po-Jen Wang, Xinyang Wang, Linying Wang, Fa-Kai Wang, Yimeng Wang, Dong-Mei Wang, Anli Wang, Hui-Li Wang, Jianqing Wang, Honglun Wang, Wei-Feng Wang, Kaihao Wang, Jialing Wang, Shuren Wang, Cui-Fang Wang, Wenqi Wang, Peilin Wang, Wen-Fei Wang, Guang-Rui Wang, T Wang, Weiqing Wang, Ciyang Wang, Biao Wang, Kaihe Wang, Jieh-Neng Wang, Tony Wang, Yuehu Wang, Zhicheng Wang, Tongtong Wang, Zi Xuan Wang, Yingtai Wang, Xin-Xin Wang, Chu Wang, Tianhao Wang, Shukui Wang, Ching C Wang, Yulin Wang, Chunyang Wang, Yeqi Wang, Yinbo Wang, Kongyan Wang, Weiling Wang, Linxuan Wang, Shengya Wang, Yaqi Wang, Huating Wang, Aiting Wang, Ya Xing Wang, Daoping Wang, Shasha Wang, Wei-Lien Wang, Quanli Wang, Yanru Wang, L M Wang, Bijue Wang, H Wang, Jipeng Wang, Xiaoxia Wang, Shuu-Jiun Wang, Baitao Wang, Haimeng Wang, Chung-Hsing Wang, Weining Wang, M Y Wang, Wenwen Wang, Zhongsu Wang, Xiaochen Wang, Ligang Wang, Shaohsu Wang, Bing Qing Wang, Jiangbin Wang, Yajun Wang, Chunting Wang, Hemei Wang, En-hua Wang, H-Y Wang, Zixi Wang, Wenjing Wang, Haikun Wang, Ruxin Wang, Jianru Wang, Yongqiang Wang, Ouchen Wang, Jianyu Wang, Shen Wang, Yixi Wang, Zhi-Hong Wang, Li Dong Wang, Zhou-Ping Wang, Wen-Yong Wang, Meng-Lan Wang, Xiaojie Wang, Leying Wang, Yi-Zhen Wang, Y Y Wang, Jianlin Wang, Guoqing Wang, Jiani Wang, Guan-song Wang, You Wang, Xiangding Wang, Ke Wang, Wendong Wang, Yue Wang, Zhe Wang, K Wang, Zhuo Wang, Su'e Wang, Cangyu Wang, Erfei Wang, Xiaoming Wang, Aijun Wang, Xiaoye Wang, Jun-Sheng Wang, Wenxiang Wang, Yanjun Wang, Qiangqiang Wang, Yachun Wang, Haitao Wang, Tiancheng Wang, Gangyang Wang, Jianmin Wang, Jiabo Wang, Yijing Wang, Mengzhi Wang, Yinuo Wang, Zhou Wang, Guiying Wang, Xuezheng Wang, Shan Wang, Aoli Wang, Fuqiang Wang, Yawei Wang, Xianxing Wang, Ya-Long Wang, Yuyang Wang, Dong Hao Wang, Y-S Wang, Zelin Wang, Liqun Wang, Cunyi Wang, Qian-Zhu Wang, Yinan Wang, Panfeng Wang, Guangwen Wang, J Q Wang, Guang Wang, Yu-Ping Wang, John Wang, Jiaping Wang, Zhisheng Wang, Xuan-Ren Wang, Xiaowu Wang, Zhengyu Wang, Baowei Wang, Zhijun Wang, Zhong-Hao Wang, Fengzhong Wang, Jin-Da Wang, Zhaoqing Wang, Yuanbo Wang, Haixin Wang, Yaping Wang, Lixiu Wang, Mingxia Wang, Neng Wang, Guozheng Wang, Yan-Feng Wang, Huafei Wang, Yuhan Wang, Xingxing Wang, Wenhe Wang, Xing-Huan Wang, Xiansong Wang, Yishan Wang, Ruming Wang, Ya Qi Wang, Yueying Wang, Chunle Wang, Shihua Wang, W Wang, Hengjun Wang, Meihui Wang, Huanyu Wang, Ruinan Wang, Qiwei Wang, Zhong Wang, Shiyao Wang, Jian-Zhi Wang, Ruimeng Wang, Jinxiang Wang, Jinsong Wang, Bin-Xue Wang, Fuwen Wang, Yiou Wang, Shifa Wang, Yin Wang, Yanzhu Wang, Jia Bin Wang, Siyang Wang, Zhanggui Wang, Yueting Wang, Qingyu Wang, Qianqian Wang, Xiu-Lian Wang, Fengling Wang, Chenxi Wang, Cheng An Wang, Yipeng Wang, Weipeng Wang, Zechen Wang, Shuaiqin Wang, Xueqian Wang, Chan Wang, Guohang Wang, Cai-Yun Wang, Jiang Wang, Huei Wang, Yufeng Wang, Heng Wang, Qing-Liang Wang, Chuang Wang, Xiaofang Wang, Hao-Ching Wang, Junying Wang, Jianwei Wang, Jinhai Wang, Hanchao Wang, Penglai Wang, I-Ching Wang, S L Wang, Tianhu Wang, Sheng-Min Wang, Pan-Pan Wang, Duan Wang, Xuqiao Wang, Minghuan Wang, Wei-Wei Wang, Xiaojian Wang, Shuping Wang, Jinfu Wang, Biqi Wang, Zhenguo Wang, Fangyan Wang, Sainan Wang, Peijuan Wang, Pei-Yu Wang, Yuyan Wang, Fuxin Wang, Ji M Wang, Yange Wang, Yali Wang, Wenhui Wang, Leishen Wang, Lichan Wang, Xianna Wang, Wenbin Wang, Kenan Wang, Chih-Yuan Wang, Yanlei Wang, Ju Wang, Yanliang Wang, Keqing Wang, Bangshing Wang, Dayan Wang, Yongsheng Wang, Dinghui Wang, Zheyue Wang, Xinke Wang, Daqing Wang, Yan Ming Wang, He-Ling Wang, Shengyao Wang, Jiwen Wang, Xizhi Wang, Luxiang Wang, Dandan Wang, RongRong Wang, Heng-Cai Wang, Jindan Wang, Xiaoding Wang, Yumeng Wang, Heling Wang, Xiao-Yun Wang, Meiding Wang, Zhilun Wang, Guo-hong Wang, Na Wang, Yanli Wang, Fubing Wang, Feixiang Wang, Zhiyuan Wang, Yi-Cheng Wang, Zhengwei Wang, Wenyuan Wang, Yu-Ying Wang, Jianqin Wang, Sijia Wang, Chuansen Wang, Huawei Wang, Kaiyan Wang, Qingyuan Wang, Yujia Wang, Lian Wang, Junrui Wang, Chao-Yung Wang, Zehao Wang, Ruixue Wang, Minjun Wang, Jin Wang, Xiaoxiao Wang, Jun-Feng Wang, Binquan Wang, Shuxia Wang, Donggen Wang, Deming Wang, Chenggang Wang, Chuduan Wang, Haichuan Wang, Catherine Ruiyi Wang, Hai-Feng Wang, Anthony Z Wang, Guanghui Wang, Jiahao Wang, Xiaosong Wang, Zijue Wang, Wenbo Wang, M-J Wang, Yu Wang, Yingping Wang, Zhengbing Wang, G Q Wang, Mengjing Wang, Zhendong Wang, Kailu Wang, Jinfeng Wang, Zhiguo Wang, Yusha Wang, Jianmei Wang, Kun Wang, Lihong Wang, Haoxin Wang, Haowei Wang, Ziqing Wang, Aihua Wang, Yuanyong Wang, Sanwang Wang, Doudou Wang, Hao-Yu Wang, Peirong Wang, Wenting Wang, Yibing Wang, He Wang, Jia-Peng Wang, Shixin Wang, En-bo Wang, Dong-Dong Wang, Hualing Wang, Hongyan Wang, Shaoying Wang, Yingjie Wang, Tianqing Wang, Guo-Hua Wang, Yongfei Wang, Lijing Wang, Hongli Wang, Zixian Wang, Niansong Wang, Liangxu Wang, Xinrong Wang, X-T Wang, Zhenning Wang, Dake Wang, Yu-Ting Wang, Zonggui Wang, Daping Wang, Joy Wang, Chenji Wang, Jingmin Wang, Yuyin Wang, Jin-Cheng Wang, Jiangbo Wang, Huiyang Wang, Chi Chiu Wang, He-Cheng Wang, Zhongjing Wang, Weina Wang, Qiaohong Wang, Qintao Wang, Jenny Y Wang, Zheyi Wang, Robert Yl Wang, Zhaotong Wang, Ya Wang, Fangyu Wang, Haobin Wang, Tianyuan Wang, Xinrui Wang, Zhehao Wang, Yihan Wang, Chuan-Jiang Wang, Jianjun Wang, Yongfeng Wang, Gaofu Wang, Ying-Piao Wang, Jingwei Wang, Mengjiao Wang, Chuyao Wang, Yanping Wang, Xinchun Wang, Shu Wang, Guibin Wang, Hong-Ying Wang, Linping Wang, Yugang Wang, Xinru Wang, Fengyun Wang, Heyong Wang, Ziping Wang, Yuegang Wang, Xiangyu Wang, Haoran Wang, Xiaomei Wang, Fang Wang, Lina Wang, Guowen Wang, Liyun Wang, Qingshui Wang, Baoyun Wang, Li-Juan Wang, Tongsong Wang, Jingyun Wang, Huiguo Wang, Zhibo Wang, Lou-Pin Wang, Renjun Wang, Huiting Wang, Junfeng Wang, Zihan Wang, Linhua Wang, Zhiji Wang, Fubao Wang, Eunice S Wang, Xiaojuan Wang, Yuewei Wang, Shuang Wang, Ruey-Yun Wang, Xiaoling Wang, Weihua Wang, Yanggan Wang, Jia Wang, Chaoqun Wang, Xiao-liang Wang, Manli Wang, Yongkang Wang, Huiwen Wang, Ting Chen Wang, Yixian Wang, Xinlin Wang, Shuya Wang, Bochu Wang, Kehao Wang, Sasa Wang, Mengshi Wang, Qiu-Ling Wang, Chengshuo Wang, Mengru Wang, Yiwei Wang, Xueyun Wang, Yijun Wang, Haomin Wang, Meng C Wang, Mengxiao Wang, Huan-You Wang, Jingheng Wang, Carol A Wang, Benjamin H Wang, Penglong Wang, Pei-Wen Wang, Jian-Long Wang, Wang Wang, Jinhui Wang, Yuanqing Wang, Jacob E Wang, Jian-Xiong Wang, Wenyu Wang, Chengze Wang, Hongmei Wang, Fengqiang Wang, Zijun Wang, Shaochun Wang, Qinwen Wang, Ruicheng Wang, Aixian Wang, Yanling Wang, Lu-Lu Wang, Linyuan Wang, Yeming Wang, Ye Wang, Tian-Yi Wang, Zhichao Wang, Dangfeng Wang, Jiucun Wang, Guo-Liang Wang, Guandi Wang, Zhuo-Xin Wang, Aili Wang, Fengliang Wang, Yingzi Wang, Lirong Wang, Xuekai Wang, Wei-En Wang, Jing-Xian Wang, Hesuiyuan Wang, Yuexin Wang, Suzhen Wang, Luping Wang, Xiuyu Wang, Zicheng Wang, Jiliang Wang, Rikang Wang, Xue Wang, Shudan Wang, Chun Wang, Hongxin Wang, Chenglong Wang, Junxiao Wang, Zhiqing Wang, Shawn Wang, Shunran Wang, Tiantian Wang, Youhua Wang, Xiao-Hui Wang, Qing-Yan Wang, Hanying Wang, Qiuping Wang, Yongzhong Wang, Jin-Xia Wang, Xiao-Tong Wang, Shun Wang, Xiaoqun Wang, Ching-Jen Wang, Xin Wang, Hanbin Wang, Yingwen Wang, Jia Bei Wang, Xiaodan Wang, Wenhan Wang, Jia-Yu Wang, Xiaozhi Wang, Xinkun Wang, Jinhao Wang, KeShan Wang, Shengdong Wang, Jinzhu Wang, Lihui Wang, Bicheng Wang, Chao-Jun Wang, Shaoyi Wang, Yajing Wang, Qing-Bin Wang, Feiyan Wang, Geng Wang, Chen Wang, Zhimin Wang, Cenxuan Wang, Wenjun Wang, Chuan-Chao Wang, Zexin Wang, Shu-Huei Wang, Yonggang Wang, Zhaoyu Wang, Xiaochuan Wang, Chuan-Hui Wang, Junshuang Wang, X F Wang, Li-Ting Wang, Chenxin Wang, Qiao-Ping Wang, Jingqi Wang, Xiongjun Wang, Shuang-Shuang Wang, Xu Wang, Houchun Wang, Yaodong Wang, Lujuan Wang, Jilin Wang, Peichang Wang, Keyun Wang, Ruixuan Wang, Zhangying Wang, Lianyong Wang, Dongyu Wang, Xinghui Wang, Binghan Wang, Guanduo Wang, Xian-e Wang, Guimin Wang, Xiaomeng Wang, Yuh-Hwa Wang, Jinru Wang, Mingyu Wang, Binbin Wang, Chaokui Wang, Linhui Wang, Youzhi Wang, Zhenqian Wang, Jialiang Wang, Sufang Wang, Haiyan Wang, Yankun Wang, Yingbo Wang, Zilong Wang, Xiao-Qun Wang, Lin-Fa Wang, Wenhao Wang, P Wang, Rui-Hong Wang, Xiao-jian WANG, Pei Chang Wang, Zhengkun Wang, Vivian Wang, Ying Wang, Zihuan Wang, Peiwen Wang, Chao Wang, Da-Zhi Wang, He-Tong Wang, Mofei Wang, Zezhou Wang, Liyong Wang, Bruce Wang, Hao-Tian Wang, Jin-Juan Wang, Yucheng Wang, Yong-Gang Wang, Saili Wang, Xiuwen Wang, Ruiquan Wang, Xinmei Wang, Zhezhi Wang, Xiao-Jie Wang, H Y Wang, Li-Dong Wang, Duanyang Wang, Kaiting Wang, Yikang Wang, Yichen Wang, Ting-Chen Wang, Meixia Wang, ZhenXue Wang, Juan Wang, Shouling Wang, Lan Wang, Li Chun Wang, Xingxin Wang, Ruibing Wang, Xue-Ying Wang, Bi-Dar Wang, Jiayang Wang, Suxia Wang, Yumin Wang, Qing Jun Wang, Xinbo Wang, Youli Wang, Yi-Ni Wang, Xinran Wang, Lixian Wang, Kan Wang, Ruiming Wang, Qing-Yuan Wang, Kai-Kun Wang, Yaoxian Wang, Qing-Jin Wang, Junmei Wang, Xin Wei Wang, J P Wang, Xufei Wang, Yuqin Wang, Handong Wang, Li-San Wang, Guoling Wang, Wenrui Wang, Zhongwei Wang, Shi-Han Wang, Ruoxi Wang, Huiping Wang, Mu Wang, Weihong Wang, Minzhou Wang, Yakun Wang, Da-Cheng Wang, Pengjie Wang, Qihua Wang, Ji-Nuo Wang, Deshou Wang, Xiaowen Wang, Yaochun Wang, Qihao Wang, Ruiying Wang, Tiange Wang, Xi Wang, Yindan Wang, Lixin Wang, Zhaofeng Wang, Guixin Wang, Erming Wang, Haoyu Wang, Kexin Wang, Yiqiao Wang, Qi-Qi Wang, Shuiyun Wang, Xi-Rui Wang, Cai-Hong Wang, Zhizheng Wang, Mingxun Wang, Liangli Wang, Theodore Wang, Alexander Wang, Huayang Wang, Yinyin Wang, Shuzhong Wang, Tingting Wang, Jiao Wang, Wenxian Wang, Jianghua Wang, Furong Wang, Shijun Wang, Le Wang, Guihua Wang, Xiaokun Wang, Xia Wang, Jiabei Wang, Guoying Wang, Zeyuan Wang, Jue Wang, Jin-E Wang, Jingru Wang, Chun-Li Wang, Xiaole Wang, Ermao Wang, Lanlan Wang, Ye-Ran Wang, Hao Wang, Xv Wang, Shikang Wang, Yufei Wang, Siyi Wang, Xiujuan Wang, Qinyun Wang, Xiangwei Wang, Jian-Hong Wang, David Q-H Wang, Chunjuan Wang, Weiyan Wang, Jia-Liang Wang, Yanxing Wang, Sheri Wang, Chenwei Wang, Haoping Wang, Sheng-Quan Wang, Xiangrong Wang, Xiao-Yi Wang, Huan Wang, Zhitao Wang, Xinyan Wang, J Wang, Kaixi Wang, Huihua Wang, Renwei Wang, Xiaoliang Wang, Xiao-Lin Wang, Tian-Lu Wang, Jiou Wang, Weiqin Wang, Jiamin Wang, Dennis Wang, Ji-Yao Wang, Pingping Wang, Jinyang Wang, Chen-Cen Wang, Chien-Wei Wang, Daolong Wang, Rong-Tsorng Wang, Yuwei Wang, Guo-Ping Wang, Zhentang Wang, F Wang, Xueju Wang, Saisai Wang, Zhehai Wang, Y B Wang, Xiao Wang, Guobing Wang, Kangmei Wang, Chunguo Wang, Longcai Wang, Haina Wang, Chih-Hsien Wang, Yuli Wang, Ling-Ling Wang, Zhangshun Wang, Xue-Lian Wang, Jianxin Wang, Da-Yan Wang, Xianghua Wang, Peng Wang, Yu Qin Wang, Zhao-Jun Wang, Rui-Rui Wang, Xingyue Wang, Man Wang, Daozhong Wang, Tian-Li Wang, Luhui Wang, Gaopin Wang, Mengze Wang, Jizheng Wang, Hong-Yan Wang, Dongying Wang, Wenkai Wang, Stephani Wang, Dan-Dan Wang, Yicheng Wang, Yusheng Wang, Junwen Wang, Gao Wang, Ruo-Nan Wang, Yifan Wang, Jueqiong Wang, Xuewei Wang, Jianning Wang, Yonglun Wang, Shiwen Wang, Lifang Wang, Fuyan Wang, Jian-Bin Wang, Chonglong Wang, Haiwei Wang, Yike Wang, Chunxia Wang, Kaijuan Wang, Minglei Wang, Jingxiao Wang, Luting Wang, David Wang, Ben Wang, Ji-zheng Wang, Yuncong Wang, Lei P Wang, Tingye Wang, Wenke Wang, Ping Wang, Min Wang, Qiang-Sheng Wang, Xuejing Wang, Zhanju Wang, Xixi Wang, Xiaodong Wang, Chaomeng Wang, Yanong Wang, Xinghao Wang, Jiaming Wang, Siyuan Wang, Jiu Wang, Ruizhi Wang, Qing Mei Wang, Wenyi Wang, Yiqing Wang, Cai Ren Wang, Lianchun Wang, Xing-Ping Wang, Xiaoman Wang, Yanjin Wang, Xueqin Wang, Chenliang Wang, Zhenshan Wang, Junhong Wang, Guiping Wang, Xianrong Wang, Xumeng Wang, Dajia Wang, Huang Wang, Huie Wang, Weiwen Wang, Ruiwen Wang, Qing Wang, Haohao Wang, Bao-Long Wang, P Jeremy Wang, Chengqiang Wang, Suli Wang, Lingyan Wang, Chi Wang, Meng Wang, Luwen Wang, Quan Wang, Yan-Jun Wang, Sen Wang, Ruining Wang, Xiaozhen Wang, Zhiping Wang, Xue-Yao Wang, Yuming Wang, Jingjing Wang, Jiazheng Wang, Yunong Wang, Chongze Wang, Rufang Wang, Qiuning Wang, Tiannan Wang, Liqing Wang, Wencheng Wang, Xuefeng Wang, Yongli Wang, Xinwen Wang, Runzhi Wang, Chaojie Wang, Wentao Wang, Zhifeng Wang, Yanan Wang, Mengqi Wang, Limin Wang, Donglin Wang, Shujin Wang, Chengbin Wang, Qiu-Xia Wang, Zhengxuan Wang, Yancun Wang, Yuhuan Wang, Wei Wang, G-W Wang, Bangmao Wang, Kejia Wang, Jinjin Wang, Qifei Wang, Guobin Wang, Chun-Lin Wang, Jing-Shi Wang, Jiheng Wang, Huajing Wang, Yanlin Wang, Chuansheng Wang, Cailian Wang, Beilan Wang, Luofu Wang, Yangpeng Wang, Jieqi Wang, Weilin Wang, Xiaoxuan Wang, Yangyufan Wang, Xiao-Fei Wang, Chen-Ma Wang, Yun Yong Wang, Shizhi Wang, B Wang, Yuling Wang, Yi-Yi Wang, Fanwen Wang, Aiyun Wang, Jian Wang, Chengyu Wang, Jing-Huan Wang, Ning Wang, Yichuan Wang, L F Wang, Chau-Jong Wang, Xin-Yang Wang, Yunzhe Wang, Xuewen Wang, Sheng-Ping Wang, Bi Wang, Qiuting Wang, Yan-Jiang Wang, Dongshi Wang, Yingna Wang, Jingyue Wang, Hongshan Wang, Chunjiong Wang, Hong-Yang Wang, Yingmei Wang, Danfeng Wang, Zhongyi Wang, Teng Wang, Chih-Hao Wang, Mingchao Wang, Yi-Chuan Wang, Chuning Wang, Shihao Wang, Ming-Wei Wang, Menglu Wang, Zhulun Wang, Wuji Wang, Dao-Xin Wang, Han Wang, Jincheng Wang, Thomas T Y Wang, Qingyun Wang, Guoliang Wang, Jihong Wang, Hong-Qin Wang, G Wang, Hsei-Wei Wang, Linfang Wang, Xiao Ling Wang, Ganyu Wang, Zhengdong Wang, Cuizhe Wang, Hongyu Wang, Tieqiao Wang, Lijuan Wang, Jingchun Wang, Youzhao Wang, Zijian Wang, Ziheng Wang, Xingyu Wang, Shuning Wang, Shaokun Wang, Zhifu Wang, Xinqi Wang, Jinqiu Wang, ZhongXia Wang, Yanyun Wang, Dadong Wang, Xingjie Wang, Yiting Wang, Zhongli Wang, Junyu Wang, Jianding Wang, Meng-Wei Wang, Yingge Wang, Zhenchang Wang, Qun Wang, Jin-Xing Wang, Lijun Wang, Shuqing Wang, Fu-Yan Wang, Sheng-Nan Wang, Feijie Wang, Qiuyan Wang, Ying-Wei Wang, Shitao Wang, Meng-hong Wang, Zhengyang Wang, Jinghong Wang, Zhiying Wang, Pei Wang, Weixue Wang, Shiyue Wang, Xiaohong Wang, Daiwei Wang, Jinghua Wang, S X Wang, Jian-Yong Wang, Zeying Wang, Can Wang, Kehan Wang, Yunzhang Wang, Jinping Wang, Chenchen Wang, Chun-Ting Wang, Yujiao Wang, Xinxin Wang, Ji Wang, Sui Wang, Wenqiang Wang, Yingwei Wang, Shuzhen Wang, Daixi Wang, Yanming Wang, Lin-Yu Wang, Hongyin Wang, Zhongqun Wang, Er-Jin Wang, Yi Wang, Ziyi Wang, Lianghai Wang, Zhendan Wang, Xiao-Ming Wang, Chengyan Wang, Hui Miao Wang, Jingyi Wang, Ranran Wang, Banghui Wang, Huilun Wang, Ai-Ting Wang, Wenxuan Wang, Yuan-Hung Wang, Zixuan Wang, Hailing Wang, Xuan-Ying Wang, Jiqiu Wang, Yalong Wang, Xiaogang Wang, Shu-qiang Wang, Yun-Jin Wang, Zijie Wang, Tianlin Wang, Mingqiang Wang, Lufang Wang, Jin'e Wang, Xiru Wang, Cuili Wang, GuoYou Wang, Zhizhong Wang, Haifei Wang, Guorong Wang, Xinyue Wang, Pei-Juan Wang, Jiangong Wang, Yingte Wang, Huajin Wang, Ruibo Wang, Kejian Wang, Cheng-Cheng Wang, Xusheng Wang, Shu-Na Wang, Panliang Wang, Mingxi Wang, Shenqi Wang, Zifeng Wang, Chaozhan Wang, Xiuyuan Hugh Wang, Yuping Wang, Xujing Wang, Kai Wang, Hongbing Wang, Sheng-Yang Wang, Jianfei Wang, Hang Wang, Jing-Jing Wang, Weizhi Wang, Jixuan Wang, De-He Wang, P L Wang, Ningjian Wang, Chunyi Wang, Isabel Z Wang, Yong Wang, Yiming Wang, Mingzhi Wang, Jiying Wang, Qian-Wen Wang, Shusen Wang, Xiaoting Wang, Baogui Wang, Mingsong Wang, Zixia Wang, Demin Wang, Shiyuan Wang, Qiuli Wang, C Wang, Dongliang Wang, Weixiao Wang, Yinsheng Wang, Chunmei Wang, Huaili Wang, Xuelian Wang, Yongjun Wang, Zhi-Qin Wang, Jiaying Wang, Yulong Wang, Ren Wang, Jingnan Wang, Qishan Wang, Zeneng Wang, Guangsuo Wang, Chijia Wang, Huiqun Wang, Hongcai Wang, Donghao Wang, Xing-Jin Wang, Zongji Wang, Shenao Wang, Jiaqian Wang, Xiaoying Wang, Yilin Wang, Hangzhou Wang, Wenchao Wang, Jieyu Wang, Li-E Wang, Xuezhen Wang, Liuyang Wang, Zhiqian Wang, Fang-Tao Wang, Qiong Wang, Meng-Meng Wang, Youji Wang, Jiafeng Wang, Xiaojing Wang, William Wang, Junmin Wang, Laijian Wang, Xuexiang Wang, Huiyan Wang, T Y Wang, Zhaofu Wang, Wen-mei Wang, Yalin Wang, Xinshuai Wang, Daqi Wang, Zhen Wang, Shi-Cheng Wang, Anni Wang, Chunhong Wang, Hai-Long Wang, Pan Wang, Charles C N Wang, Pengxiang Wang, Xianzong Wang, Xike Wang, Qianliang Wang, Chunyan Wang, Xuan Wang, Xiaofen Wang, Zhi-Jian Wang, Feng-Sheng Wang, Xiangru Wang, R Wang, Yi-Shu Wang, Jia-Lin Wang, Yonghong Wang, Lintao Wang, Pai Wang, Yanfei Wang, Xuanwen Wang, Lei-Lei Wang, Chenxuan Wang, James Wang, Xinhui Wang, Shengqi Wang, Yueshen Wang, Shan-Shan Wang, Dingting Wang, Zhige Wang, Jingfeng Wang, Yongqing Wang, Chenyang Wang, Ziliang Wang, Bao Wang, Xueyan Wang, Liping Wang, Xingde Wang, Weijun Wang, Sibo Wang, Yaoling Wang, Donghong Wang, Chenyu Wang, Justin Wang, Baolong Wang, Yiqi Wang, Fengyong Wang, Lichao Wang, Yachen Wang, Quanren Wang, Shiyu Wang, Boyu Wang, Aimin Wang, Zhenghui Wang, Hengjiao Wang, Xiaoxin X Wang, Weimin Wang, Mutian Wang, Zhuo-Hui Wang, Xingye Wang, Zou Wang, Yu-Wen Wang, Shaoli Wang, Xin-Ming Wang, Weirong Wang, Kangli Wang, Yaoxing Wang, Xuejie Wang, Qifeng Wang, Xiaoxin Wang, Yinghui Wang, Jianzhang Wang, Tom J Wang, Yaqiong Wang, Zongwei Wang, Yun-Hui Wang, Haiyun Wang, Zhiyou Wang, Lijin Wang, Jifei Wang, Haiyong Wang, Xiao-Xia Wang, Shyi-Gang P Wang, Chih-Yang Wang, Zhixin Wang, Jun-Jun Wang, Tianjing Wang, Zhixia Wang, Chuanhai Wang, Zhijie Wang, Silu Wang, Jianguo Wang, Ming-Hsi Wang, Liling Wang, Yanting Wang, Haolong Wang, Xue-Lei Wang, Ru Wang, Qinglin Wang, Christina Wang, Mimi Wang, Menghui Wang, Wenju Wang, Junhua Wang, S S Wang, Fangyong Wang, Lifen Wang, Zhenbin Wang, Yapeng Wang, Shaoshen Wang, B R Wang, Sugai Wang, Hequn Wang, Songlin Wang, Wenjie Wang, Xiang-Dong Wang, Ting-Hua Wang, Mingliang Wang, Chengniu Wang, Guoxiang Wang, E Wang, Xiaochun Wang, Xueting Wang, Ming-Jie Wang, Zhaojing Wang, Dongxu Wang, Yirui Wang, Jiatao Wang, Jing-Min Wang, Shih-Wei Wang, Zhengchun Wang, Chaoxian Wang, Zehua Wang, Qiyu Wang, Shuye Wang, Baojun Wang, Qing Kenneth Wang, Xichun Wang, Jianliu Wang, Junping Wang, Yudong Wang, Mingzhu Wang, Kangning Wang, Wei-Ting Wang, Hongfang Wang, Chengwen Wang, Changduo Wang, Jinkang Wang, Junya Wang, Fengge Wang, Jianping Wang, Chang Wang, Zhifang Wang, Deli Wang, Linghua Wang, Shitian Wang, Lingling Wang, Zhihua Wang, Jun-Ling Wang, Keyi Wang, Lingbing Wang, Peijia Wang, Ruizhe Wang, X O Wang, Wanyi Wang, Ganggang Wang, Pei-Hua Wang, Kaiyue Wang, Xiaojiao Wang, Xun Wang, Shiyang Wang, Ya-Ping Wang, Yirong Wang, Lixing Wang, Danyang Wang, Xiaotang Wang, Taian Wang, Ming Wang, Xiangcheng Wang, Xuemei Wang, Zhixiong Wang, Mengying Wang, Li-Yong Wang, Xinchao Wang, Jianlong Wang, Jinjie Wang, Nan Wang, Weidong Wang, Mei-Gui Wang, L-S Wang, Wuqing Wang, Z Wang, Ya-Zhou Wang, Xincheng Wang, Jing-Wen Wang, Jinyue Wang, Hongyun Wang, Huaizhi Wang, Yan-Zi Wang, Danling Wang, Dongqin Wang, Hongzhuang Wang, Chung-Teng Wang, Yan-Chun Wang, Shi-Xin Wang, Muxuan Wang, Yujie Wang, Yunbing Wang, Yahui Wang, Zhihong Wang, Xiaoshan Wang, Tienju Wang, Chiou-Miin Wang, Yuqian Wang, Shengyuan Wang, Yumei Wang, Ningyuan Wang, Minjie Wang, Zhenda Wang, Qing-Dong Wang, Horng-Dar Wang, Siqi Wang, Kaihong Wang, Hong-Kai Wang, Meiling Wang, Jiaxing Wang, Xueyi Wang, Zhuozhong Wang, Anlai Wang, Julie Wang, Jin-Bao Wang, Keke Wang, Zhang Wang, Yintao Wang, Yong-Bo Wang, Bing Wang, Dalu Wang, Minxian Wang, Zulong Wang, Gao T Wang, Gang Wang, Sophie H Wang, Xinquan Wang, Yi-Ting Wang, Honglian Wang, Ruyue Wang, Jia-Qiang Wang, Seungwon Wang, Shusheng Wang, Yanbin Wang, Chang-Yun Wang, Le-Xin Wang, Juling Wang, Haohui Wang, Chuanyue Wang, Tianqin Wang, Danqing Wang, Keyan Wang, Yeou-Lih Wang, Qinglu Wang, Sun Wang, Rui-Min Wang, Yong-Tang Wang, Xianwei Wang, Lixia Wang, Tong Wang, Xiaonan Wang, Feida Wang, Jiaxuan Wang, Mingrui Wang, Zixiang Wang, Y Z Wang, Yuliang Wang, Ming-Chih Wang, J J Wang, Huina Wang, Jingang Wang, Jinyun Wang, Min-sheng Wang, Wanyao Wang, Ziqiu Wang, Guo-Quan Wang, Xueping Wang, Qixue Wang, Hechuan Wang, Shang Wang, Chaohan Wang, M H Wang, L Z Wang, Jianhui Wang, Xifeng Wang, Xiaorong Wang, Yinong Wang, Zhixiu Wang, Jiaxi Wang, Jiahui Wang, Xiaofei Wang, Feifei Wang, Kesheng Wang, Rong-Chun Wang, Zhi-Xin Wang, Chaoyu Wang, Yongkuan Wang, Zuoyan Wang, Hsueh-Chun Wang, Xixiang Wang, Guanrou Wang, Songsong Wang, Hongyuan Wang, Yubing Wang, Xuliang Wang, Wen-Ying Wang, Xinglei Wang, Dao-Wen Wang, Yun Wang, Ze Wang, Jiyan Wang, Zai Wang, Guan Wang, Chih-Chun Wang, Yiqin Wang, X S Wang, Hongzhan Wang, Exing Wang, Shu-Jin Wang, Shangyu Wang, Shouzhi Wang, Yunduan Wang, Jiyong Wang, Dongdong Wang, Qingzhong Wang, Zi-Qi Wang, Renyuan Wang, Siyu Wang, Donghui Wang, Ming-Yuan Wang, Juxiang Wang, Muxiao Wang, Fu Wang, Fei Wang, Qiuyu Wang, Ertao Wang, Zhi Xiao Wang, Zunxian Wang, Hui-Nan Wang, Rongping Wang, Won-Jing Wang, Leiming Wang, Pu Wang, Shen-Nien Wang, Xiaona Wang, Meng-Ying Wang, Wen-Jie Wang, Jiaxin Wang, RuNan Wang, Jiemei Wang, Ningli Wang, Zhong-Hui Wang, Hong Wang, Hui-Yu Wang, Ziqian Wang, Xinzhou Wang, Zhoufeng Wang, Weiguang Wang, Zusen Wang, Jiajia Wang, Bin Wang, Shu-Xia Wang, Yu'e Wang, Laidi Wang, Xiao-Li Wang, Lu Wang, Zhugang Wang, Maojie Wang, Ganglin Wang, Xinyu Wang, Junlin Wang, Dong Wang, Yao Wang, Ya-Jie Wang, Zhiwu Wang, DongWei Wang, Hongdan Wang, Yanxia Wang, Maiqiu Wang, Guansong Wang, Qingtong Wang, Yingcheng Wang, Wenjuan Wang, Liying Wang, Xiaolong Wang, Weihao Wang, Qiushi Wang, Yingfei Wang, Haoyang Wang, Li-Li Wang, Yanbing Wang, Yingchun Wang, Guangming Wang, Kaiyuan Wang, Shiqi Wang, Qi-En Wang, Song Wang, Jing-Hao Wang, Lynn Yuning Wang, Zekun Wang, Rui-Ping Wang, Yining E Wang, Yuzhou Wang, Liu Wang, Maochun Wang, Cindy Wang, Qian-Liang Wang, Duo-Ping Wang, Linlin Wang, Taishu Wang, Xiang Wang, Qirui Wang, Baoming Wang, Liting Wang, Jiapan Wang, Lingda Wang, Xietong Wang, Jia-Mei Wang, Liwei Wang, Shaozheng Wang, Q Wang, Timothy C Wang, Mengyue Wang, Xing Wang, Yahong Wang, Yuyong Wang, Yujiong Wang, Guangliang Wang, Ya-Qin Wang, Yezhou Wang, Hongjian Wang, Su-Hua Wang, Qian-fei Wang, Meng-Dan Wang, Yuchen Wang, Hongpin Wang, Pengfei Wang, Ge Wang, Meijun Wang, Yan-Ming Wang, Haichao Wang, Tzung-Dau Wang, Runci Wang, Yan-Yi Wang, Cheng-Jie Wang, Chen-Yu Wang, Cong Wang, Yaxuan Wang, Y H Wang, Yongjie Wang, Yuntai Wang, Ranjing Wang, Yiru Wang, Anxiang Wang, Q Z Wang, Shimiao Wang, Guoping Wang, Junke Wang, Xingyun Wang, Zhengyi Wang, Shi-Qi Wang, Yanfeng Wang, Danxin Wang, Chaodong Wang, Zhiqi Wang, Chunyu Wang, Lijia Wang, Chunlong Wang, Haiping Wang, Qingfa Wang, Yu-Fan Wang, Baihan Wang, Chunxue Wang, Liewei Wang, Xinyi Wang, Fu-Zhen Wang, Qing-Mei Wang, Sheng Wang, Yi-Tao Wang, Dawei Wang, Xiaoyu Wang, Ziling Wang, Zhonglin Wang, Rurong Wang, Qingchun Wang, Qiang Wang, Suiyan Wang, Xu-Hong Wang, Jie Jin Wang, Chenyao Wang, Fei-Yan Wang, Shi Wang, Zhiyong Wang, Jieda Wang, Xiaoqi Wang, Linshu Wang, Ruxuan Wang, Qian Wang, Qianxu Wang, Fangjie Wang, Zhaoxia Wang, Jeremy R Wang, Mingmei Wang, Jingkang Wang, Jen-Chun Wang, Changyuan Wang, Chenglin Wang, Meng-Ru Wang, Tianpeng Wang, Zhongfang Wang, Xuedong Wang, Zhuoying Wang, Bingyu Wang, Xuelai Wang, Weilong Wang, Mengge Wang, Qin Wang, Da-Li Wang, Xuanyi Wang, Hongjuan Wang, Zhi-Hua Wang, Hong-Wei Wang, Yulai Wang, Gongming Wang, Yongni Wang, Mengya Wang, Yadong Wang, Chenghao Wang, Hongbo Wang, Kaiming Wang, Haonan Wang, Guanyun Wang, Yilu Wang, Quanxi Wang, Weiyuan Wang, Xiujun Wang, Liang-Yan Wang, Jianshe Wang, Yingxiong Wang, Cunchuan Wang, Jing-Zhai Wang, Yuelong Wang, Yuqi Wang, Xiaorui Wang, Qianjin Wang, Huijun Wang, Xiaobo Wang, Guoqian Wang, Luhong Wang, Kaining Wang, Chaohui Wang, Yanhong Wang, J-Y Wang, Qi-Bing Wang, Xiaohu Wang, Jiayan Wang, Cui-Shan Wang, Lulu Wang, Yong-Jie Wang, Shixuan Wang, Yuanyuan Wang, Jianying Wang, Haizhen Wang, Shuiliang Wang, Qianbao Wang, Jung-Pan Wang, Rixiang Wang, A Wang, Hanbing Wang, Caiqin Wang, Peigeng Wang, Yuan Wang, Yuzhuo Wang, Yubo Wang, Xianding Wang, Qiaoqi Wang, Cuiling Wang, Ai-Ling Wang, Hailong Wang, Yihao Wang, Lan-Wan Wang, Haihe Wang, S Wang, Sha Wang, Xiaoli Wang, David Q H Wang, Jianfang Wang, Yuting Wang, Jinhuan Wang, Kaixu Wang, Hongwei Wang, Yi-Wen Wang, Yizhe Wang, Shengyu Wang, Yanmei Wang, Huimin Wang, Youjie Wang, Kunhua Wang, Chongjian Wang, Ziyun Wang, Tianhui Wang, Huiying Wang, Yue-Nan Wang, Peiyin Wang, Hongbin Wang, Hong Yi Wang, Xinjun Wang, Yian Wang, Liyi Wang, Yunce Wang, Yi-Xuan Wang, Yitao Wang, Jiali Wang, Junqin Wang, Yuebing Wang, Yiping Wang, Yunpeng Wang, Yuxing Wang, Shuqi Wang, Ziyu Wang, Hongjie Wang, Xiaoyan Wang, Lianshui Wang, Xiaolu Wang, Wenya Wang, Fan Wang, Jinhua Wang, Sidan Wang, Lixiang Wang, Y L Wang, Xue-Rui Wang, Kai-Wen Wang, Zhongyu Wang, Xiaoyang Wang, Hongyang Wang, Rencheng Wang, Yinxiong Wang, Yuanli Wang, Zhuqing Wang, Y-H Wang, Yuhui Wang, Xitian Wang, Weizhen Wang, Qi Wang, Qiyuan Wang, Changlong Wang, Yatao Wang, Tengfei Wang, Yehan Wang
articles
Yan Chi, Le Wang, Yuanyuan Liu +8 more · 2014 · Atherosclerosis · Elsevier · added 2026-04-24
ATP binding cassette transporter A1 (ABCA1) is a member of the ATP-binding cassette transporter family. It plays an essential role in mediating the efflux of excess cholesterol. It is known that perox Show more
ATP binding cassette transporter A1 (ABCA1) is a member of the ATP-binding cassette transporter family. It plays an essential role in mediating the efflux of excess cholesterol. It is known that peroxisome proliferator-activated receptor gamma (PPARγ) promoted ABCA1 expression. We previously found 7-ketocholesteryl-9-carboxynonanoate (oxLig-1) upregulated ABCA1 partially through CD36 mediated signals. In the present study, we intended to test if PPARγ signally is involved in the upregulation mediated by oxLig-1. First, we docked oxLig-1 and the ligand-binding domain (LBD) of PPARγ by using AutoDock 3.05 and subsequently confirmed the binding by ELISA assay. Western blotting analyses showed that oxLig-1 induces liver X receptor alpha (LXRα), PPARγ and consequently ABCA1 expression. Furthermore, oxLig-1 significantly enhanced ApoA-I-mediated cholesterol efflux. Pretreatment with an inhibitor for PPARγ (GW9662) or/and LXRα (GGPP) attenuated oxLig-1-induced ABCA1 expression. Under PPARγ knockdown by using PPARγ-shRNA, oxLig-1-induced ABCA1 expression and cholesterol efflux in THP-1 macrophages was blocked by 62% and 25% respectively. These observations suggest that oxLig-1 is a novel PPARγ agonist, promoting ApoA-I-mediated cholesterol efflux from THP-1 macrophages by increasing ABCA1 expression via induction of PPARγ. Show less
no PDF DOI: 10.1016/j.atherosclerosis.2014.01.052
NR1H3
Xiao-long Lin, Xing-Lan He, Jun-Fa Zeng +4 more · 2014 · DNA and cell biology · added 2026-04-24
FGF21, a member of the fibroblast growth factor superfamily, is an important endogenous regulator of systemic glucose and lipid metabolism. Elevated serum FGF21 levels have been reported in subjects w Show more
FGF21, a member of the fibroblast growth factor superfamily, is an important endogenous regulator of systemic glucose and lipid metabolism. Elevated serum FGF21 levels have been reported in subjects with coronary heart disease and carotid artery plaques. However, whether FGF21 is associated with atherosclerotic diseases remains unclear. In this study, the effects of FGF21 on cholesterol efflux in THP1 macrophage-derived foam cells and the underlying mechanisms were investigated. THP1 macrophage-derived foam cells were incubated with 0, 25, 50, 100, 200, and 400 ng/mL of FGF21 for varying time periods (0, 6, 12, and 24 h). Cholesterol efflux onto apoA-1 was assessed by high-performance liquid chromatography assays, while change in ABCA1 expression was analyzed by western blot and real-time quantitative PCR. Incubation was performed with the ERK1/2-specific inhibitor PD98059, PPARγ-specific inhibitor GW9662, and LXRα siRNA. Our results show that FGF21 promotes cholesterol efflux and ABCA1 expression in THP1 macrophage-derived foam cells in a dose- and time-dependent manner. In addition, inhibition of ERK1/2 or PPARγ, or knockdown of LXRα attenuated FGF21-mediated promotion of ABCA1 expression and cholesterol efflux. These results demonstrate that FGF21 can promote cholesterol efflux by upregulating ABCA1 through the ERK1/2-PPARγ-LXRα pathway in THP1 macrophage-derived foam cells. Show less
no PDF DOI: 10.1089/dna.2013.2290
NR1H3
Jing-Min Wang, Dong Wang, Yu-Yan Tan +2 more · 2014 · Biochemical and biophysical research communications · Elsevier · added 2026-04-24
Cholesterosis is a disease of cholesterol metabolism characterized by the presence of excessive lipid droplets in the cytoplasm. These lipid droplets are mainly composed of cholesterol esters derived Show more
Cholesterosis is a disease of cholesterol metabolism characterized by the presence of excessive lipid droplets in the cytoplasm. These lipid droplets are mainly composed of cholesterol esters derived from free cholesterol. The removal of excess cholesterol from gallbladder epithelial cells (GBECs) is very important for the maintenance of intracellular cholesterol homeostasis and the preservation of gallbladder function. Several lines of evidence have indicated that the activation of either peroxisome proliferator-activated receptor gamma (PPARγ) or liver X receptor α (LXRα) relates to cholesterol efflux. While pioglitazone can regulate the activation of PPARγ, 22(R)-hydroxycholesterol can activate LXRα and is a metabolic intermediate in the biosynthesis of steroid hormones. However, the effect of 22(R)-hydroxycholesterol in combination with pioglitazone on cholesterosis of the gallbladder is unclear. GBECs were treated with pioglitazone, 22(R)-hydroxycholesterol or PPARγ siRNA followed by Western blot analysis for ATP-binding cassette transporter A1 (ABCA1), PPARγ and LXRα. Cholesterol efflux to apoA-I was determined, and Oil Red O staining was performed to monitor variations in lipid levels in treated GBECs. Our data showed that 22(R)-hydroxycholesterol can modestly up-regulate LXRα while simultaneously increasing ABCA1 by 56%. The combination of 22(R)-hydroxycholesterol and pioglitazone resulted in a 3.64-fold increase in ABCA1 expression and a high rate of cholesterol efflux. Oil Red O staining showed an obvious reduction in the lipid droplets associated with cholesterosis in GBECs. In conclusion, the present findings indicate that the anti-lipid deposition action of 22(R)-hydroxycholesterol combined with pioglitazone involves the activation of the PPARγ-LXRα-ABCA1 pathway, increased ABCA1 expression and the efflux of cholesterol from GBECs. Thus, 22(R)-hydroxycholesterol synergistically combined with pioglitazone to produce a remarkable effect on lipid deposition in cholesterosis GBECs. Show less
no PDF DOI: 10.1016/j.bbrc.2014.03.130
NR1H3
Hongxia Yang, Shijie Zheng, Yiguo Qiu +5 more · 2014 · Investigative ophthalmology & visual science · added 2026-04-24
To investigate whether a synthetic LXR agonist TO901317 (TO90) ameliorates ocular inflammation in a mouse model of experimental autoimmune uveitis (EAU) and to explore its underlying mechanism. EAU wa Show more
To investigate whether a synthetic LXR agonist TO901317 (TO90) ameliorates ocular inflammation in a mouse model of experimental autoimmune uveitis (EAU) and to explore its underlying mechanism. EAU was induced with subcutaneous injection of IRBP161-180 peptide (SGIPYIISYLHPGNTILHVD) in B10.RIII mice. TO90 (50 mg/kg/d) or vehicle was administrated orally for successive 16 days or 8 days as prevention or effector phase, respectively. The severity of EAU was evaluated with clinical and histological scores. The levels of LXRs, NF-κB subunit p65, and an LXR target gene ABCA1 in the retina were detected with real-time PCR and Western blotting. The expressions of proinflammatory genes, including TNF-α, IL-1β, IL-6, MCP-1, IFN-γ, and IL-17, were detected by real-time PCR. IRBP-specific lymphocyte proliferation was detected by MTT. Intracellular IFN-γ and IL-17 in CD4(+) T cells were measured by flow cytometry. We found both LXRα and LXRβ were expressed in mouse retina. After administering TO90 orally to B10.RIII mice, the expression of LXRα but not LXRβ was upregulated in the naïve mice. Compared with naïve mice, LXRα expression was increased in vehicle and TO90-treated EAU mice, but the LXRβ expression was unchanged. The protein level of ABCA1 was enhanced in TO90-treated naïve and EAU mice but was unchanged in vehicle-treated EAU mice, suggesting activation of LXRα by TO90 is ligand dependent. TO90-mediated activation of LXRα improved the clinical and morphological scores in EAU mice. Meanwhile, activation of LXRα decreased the expressions of proinflammatory cytokines, including TNF-α, IL-1β, IL-6, MCP-1, IFN-γ, and IL-17 in the retina. TO90 treatment inhibited IRBP-specific immune responses. The proportions of Th1 and Th17 expressing IFN-γ and IL-17 were reduced in TO90-treated EAU mice in both prevention and effector phases. Furthermore, TO90 significantly downregulated the expressions of an NF-κB subunit p65 at the protein and mRNA levels. TO90 activates LXRα and potently attenuates ocular inflammation in EAU. Alleviation of ocular inflammation could partially result from inhibition of the NF-κB signaling pathway. TO90 reduces IFN-γ and IL-17 expression in both prevention and treatment scenarios. Our data suggest that the LXR agonist may become a novel class of therapeutic agent for autoimmune uveitis. Show less
no PDF DOI: 10.1167/iovs.13-13323
NR1H3
Jia-Yi Zhao, Yan-wei Hu, Shu-Fen Li +8 more · 2014 · Lipids in health and disease · BioMed Central · added 2026-04-24
Apolipoprotein M (apoM), as a novel apolipoprotein which is mainly expressed in liver and kidney tissues, is associated with development and progression of atherosclerosis and diabetes. Our group have Show more
Apolipoprotein M (apoM), as a novel apolipoprotein which is mainly expressed in liver and kidney tissues, is associated with development and progression of atherosclerosis and diabetes. Our group have recently shown that Dihydrocapsaicin(DHC)can significantly decrease atherosclerotic plaque formation in apoE-/- mice. However, the effect and possible mechanism of DHC on apoM expression remain unclear. HepG2 cells were treated with 0 μM, 25 μM, 50 μM and 100 μM DHC for 24 h or were treated with 100 μM DHC for 0, 6, 12, and 24 h, respectively. The mRNA levels and protein levels were measured by real-time quantitative PCR and western blot analysis, respectively. We found that DHC markedly decreased expression of apoM at both mRNA and protein level in HepG2 cells in a dose-dependent and time-dependent manner. Expression of Foxa2 was decreased while expression of LXRα was increased by DHC treatment in HepG2 cells. In addittion, overexpression of Foxa2 markedly compensated the inhibition effect induced by DHC on apoM expression. LXRα small interfering RNA significantly abolished the inhibition effect which induced by DHC on apoM expression. The liver of C57BL/6 mice treated with DHC had significantly lower expression of apoM. Furthermore, the liver had lower expression of Foxa2 while had higher expression of LXRα. DHC could down-regulate apoM expression through inhibiting Foxa2 expression and enhancing LXRα expression in HepG2 cells. Show less
no PDF DOI: 10.1186/1476-511X-13-50
NR1H3
Xiang-liang Xu, En-bo Wang, Nian-hui Cui · 2014 · Beijing da xue xue bao. Yi xue ban = Journal of Peking University. Health sciences · added 2026-04-24
To get the stem cells from the young permanent tooth apical papillae, and observe the osteogenic differentiation of the cells after cultured with acellular dermal matrix (ADM). Young permanent tooth a Show more
To get the stem cells from the young permanent tooth apical papillae, and observe the osteogenic differentiation of the cells after cultured with acellular dermal matrix (ADM). Young permanent tooth apical papillae were obtained by the oral surgeon. The cells from the apical papillae were isolated, cultured and analyzed through a flow cytometer. The cells in the experimental group were induced both osteogenic and adipogenic differentiation. The cells were not induced in the control group.Both groups were evaluated by staining and real-time polymerase chain reaction (real-time PCR) to examine the quantity of RNAs in the experimental group. The cells from apical papillae were also cultured with ADM. These cells were also induced both osteogenic and adipogenic differentiation in the experimental group, and not induced in the control group. The measures of staining and real-time PCR were also carried out. The cells from the apical papillae proliferated in a rapid rate. Of which 70.3% in cultures were positive for Stro-1, and 96% positive for CD105 according to flow cytometric analysis. After induction, the RNA level related to osteogenic and adipogenic differentiation expressed higher in the experimental group than those of the control group without induction obviously, such as osteocalcin (OCN), bone sialoprotein (BSP), liver X-recepter α (LXRα), lipoprotein lipase(LPL), peroxisome proliferator activated receptor γ (PPAR-γ), and scavenger receptor class B type 1(SR-B1). The cells cultured with ADM also had a fast proliferation, and grew attached to ADM. After induction, the RNA level of OCN and BSP had a higher expression than the control group (P > 0.05), and LPL also expressed higher (P < 0.05). The study approved that there were a big amount of stem cells in the young permanent tooth apical papilla obtained by oral surgery, which had significant osteogenic potential. The cells still proliferated well when they were cultured with ADM as a kind of collagen skelecton. The results showed that ADM could be performed as a base to support the stem cells to survive the environment, and it also could play a role in osteogenic differentiation of stem cells from apical papilla. Show less
no PDF
NR1H3
Lulu Wang, Xianping Huang, Su Hu +3 more · 2014 · Chinese medical journal · added 2026-04-24
Statin therapy has affected glucose homoeostasis of type 2 diabetes patients, which could be related with bile acids metabolism. Whether bile acid metabolism and the expression of farnesoid X receptor Show more
Statin therapy has affected glucose homoeostasis of type 2 diabetes patients, which could be related with bile acids metabolism. Whether bile acid metabolism and the expression of farnesoid X receptor (FXR), liver X receptor-α (LXR-α) and sterol regulatory element-binding protein (Srebp)-1c is regulated by hyperglycemia, or whether simvastatin therapy led to higher glucose is related with down-regulated expression of FXR in diabetic rats remained unclear. Forty male Wistar rats were randomly divided into four groups: normal control rats, insulin resistance rats, diabetic model rats, and the late simvastatin induced diabetic rats. Normal control rats were fed with standard diet, others were fed with high-fat diet. Diabetic model rats were induced by a single intraperitoneal injection of streptozotocin (STZ). The late simvastatin induced diabetic rats started simvastatin administration after STZ induced diabetic model rats. Characteristics of fasting blood glucose (FPG), lipid files and total bile acids (TBAs) were measured and the oral glucose tolerance test (OGTT) was performed after overnight fasting at the eighth weekend. RNA and protein levels of FXR, LXR-α and Srebp-1c were tested by Western blotting and reverse transcription polymerase chain reaction (RT-PCR). The insulin resistance rats showed higher glucose, lipid files and lower expression of FXR compared with normal control rats (P > 0.05). The diabetic model rats showed significantly higher glucose, lipid files, TBA and lower expression of FXR compared with insulin resistance rats (P < 0.05). The late simvastatin induced diabetic rats displayed higher glucose and TBA and lower expression of FXR compared with diabetic model rats (P < 0.05). Changes in bile acid homeostasis, including the alterations of bile acid levels and bile acid receptors, are either a cause or a consequence of the metabolic disturbances observed during diabetic models. Statin therapy induced hyperglycemia may be related with FXR, SHP, LXR-α and Srebp-1 pathways. Show less
no PDF
NR1H3
Qixue Wang, Xingzhe Ma, Yuanli Chen +8 more · 2014 · The Biochemical journal · added 2026-04-24
LXR (liver X receptor) is a ligand-activated transcription factor and plays an important role in regulation of lipid homoeostasis and inflammation. Several studies indicate that LXR inhibits IFN-γ (in Show more
LXR (liver X receptor) is a ligand-activated transcription factor and plays an important role in regulation of lipid homoeostasis and inflammation. Several studies indicate that LXR inhibits IFN-γ (interferon γ)-induced biological responses; however, the influence of LXR on IFN-γ expression has not been fully elucidated. In the present study, we investigated the effects of LXR activation on IFN-γ expression at different levels. At the molecular level, we surprisingly observed that LXR ligand (T0901317) induced macrophage and T-cell IFN-γ protein expression which was associated with increased mRNA and secreted protein levels in culture medium. In contrast, selective inhibition of LXRα and/or LXRβ expression by siRNA reduced IFN-γ expression. Promoter analysis defined the multiple LXREs (LXR-responsive elements) in the proximal region of the IFN-γ promoter. EMSAs and ChIP indicated that LXR activation enhanced the binding of LXR protein to these LXREs. In vivo, T0901317 increased wild-type mouse serum IFN-γ levels and IFN-γ expression in the lung and lymph nodes. Functionally, we observed that administration of T0901317 to wild-type mice increased rates of survival and being tumour-free, and inhibited tumour growth when the animals were inoculated with LLC1 carcinoma. In contrast, these protective effects were substantially attenuated in IFN-γ-knockout (IFN-γ-/-) mice, suggesting that the induction of IFN-γ production plays a critical role in T0901317-inhibited tumour growth. Taken together, the results of the present study show that IFN-γ is another molecular target of LXR activation, and it suggests a new mechanism by which LXR inhibits tumour growth. Show less
no PDF DOI: 10.1042/BJ20131442
NR1H3
Huan Wang, Yan Liu, Ling Zhu +6 more · 2014 · International journal of molecular medicine · added 2026-04-24
Estrogen has pleiotropic effects on the cardiovascular diseases, yet the underlying mechanisms remain incompletely understood. Cholesterol efflux is a key mechanism through which to prevent foam cell Show more
Estrogen has pleiotropic effects on the cardiovascular diseases, yet the underlying mechanisms remain incompletely understood. Cholesterol efflux is a key mechanism through which to prevent foam cell formation and the development of atherosclerosis. Recent studies highlight the role of vascular smooth muscle cell (VSMC)-derived foam cells in atherogenesis. However, it remains unclear whether estrogen promotes cholesterol efflux from VSMCs and inhibits VSMC-derived foam cell formation. In the present study, we demonstrated that 17β-estradiol (E2) markedly enhanced cholesterol efflux to apolipoprotein (apo)A-1 and high-density lipoprotein (HDL) and attenuated oxidized low-density lipoprotein (ox-LDL) induced cholesteryl ester accumulation in VSMCs, which was associated with an increase in the expression of ATP-binding cassette transporters ABCA1 and ABCG1. The upregulation of ABCA1 and ABCG1 expression by E2 resulted from liver X receptor (LXR)α activation, which was confirmed by the prevention of the expression of ABCA1 and ABCG1 after inhibition of LXRα with a pharmacological inhibitor or small interfering RNA (siRNA). Furthermore, E2 increased LXRα, ABCA1 and ABCG1 expression in VSMCs via the estrogen receptor (ER), and the involvement of ERβ was confirmed by the use of selective ERα or ERβ antagonists (MPP and PHTPP) and agonists (PPT and DPN). These findings suggest that E2 promotes cholesterol efflux from VSMCs and reduces VSMC-derived foam cell formation via ERβ- and LXRα-dependent upregulation of ABCA1 and ABCG1 and provide novel insights into the anti-atherogenic properties of estrogen. Show less
no PDF DOI: 10.3892/ijmm.2014.1619
NR1H3
Ni Li, Yanni Xu, Tingting Feng +4 more · 2014 · Journal of biomolecular screening · SAGE Publications · added 2026-04-24
Liver X receptor α (LXRα) plays an important role in reverse cholesterol transport (RCT), and activation of LXRα could reduce atherosclerosis. In the present study, we developed a screening method to Show more
Liver X receptor α (LXRα) plays an important role in reverse cholesterol transport (RCT), and activation of LXRα could reduce atherosclerosis. In the present study, we developed a screening method to identify new potential LXRα agonists using an LXRα-GAL4 chimera reporter assay. A novel analogue of N,N-disubstituted 2,8-diazaspiro[4.5]decane, IMB-151, was identified as an LXRα agonist by using this method. IMB-151 showed a significant activation effect on LXRα, with an EC50 value of 1.47 µM. IMB-151 also increased the expression of ATP-binding cassette transporter A1 (ABCA1) and G1 (ABCG1) in RAW264.7 macrophages. The upregulating effects of IMB-151 on ABCA1 and ABCG1 markedly decreased when coincubated with geranylgeranyl pyrophosphate (GGPP) ammonium salt or LXRα small interfering RNA (siRNA). Our data indicated that the upregulation of ABCA1 and ABCG1 by IMB-151 depended on activation of LXRα. Moreover, IMB-151 significantly reduced cellular lipid accumulation and increased cholesterol efflux in RAW264.7 macrophages. Interestingly, IMB-151 slightly increased sterol response element binding protein 1c (SREBP-1c) protein expression levels in HepG2 cells compared with TO901317, and this indicated that IMB-151 might have less lipogenesis side effect in vivo. These results suggested that IMB-151 was identified as a selective agonist for LXRα by using a screening method and could be used as a potential antiatherosclerotic lead compound in the future. Show less
no PDF DOI: 10.1177/1087057113516004
NR1H3
Monika Patel, Xiaoxin X Wang, Lilia Magomedova +10 more · 2014 · Diabetologia · Springer · added 2026-04-24
Liver X receptors (LXRs) α and β are nuclear hormone receptors that are widely expressed in the kidney. They promote cholesterol efflux from cells and inhibit inflammatory responses by regulating gene Show more
Liver X receptors (LXRs) α and β are nuclear hormone receptors that are widely expressed in the kidney. They promote cholesterol efflux from cells and inhibit inflammatory responses by regulating gene transcription. Here, we hypothesised (1) that LXR deficiency would promote renal decline in a mouse model of diabetes by accelerating intraglomerular cholesterol accumulation and, conversely, (2) that LXR agonism would attenuate renal decline in diabetes. Diabetes was induced with streptozotocin (STZ) and maintained for 14 weeks in Lxrα/β (+/+) (Lxrα, also known as Nr1h3; Lxrβ, also known as Nr1h2) and Lxrα/β (-/-) mice. In addition, STZ-injected DBA/2J mice were treated with vehicle or the LXR agonist N,N-dimethyl-hydroxycholenamide (DMHCA) (80 mg/kg daily) for 10 weeks. To determine the role of cholesterol in diabetic nephropathy (DN), mice were placed on a Western diet after hyperglycaemia developed. Even in the absence of diabetes, Lxrα/β (-/-) mice exhibited a tenfold increase in the albumin:creatinine ratio and a 40-fold increase in glomerular lipid accumulation compared with Lxrα/β (+/+) mice. When challenged with diabetes, Lxrα/β (-/-) mice showed accelerated mesangial matrix expansion and glomerular lipid accumulation, with upregulation of inflammatory and oxidative stress markers. In the DN-sensitive STZ DBA/2J mouse model, DMHCA treatment significantly decreased albumin and nephrin excretion (by 50% each), glomerular lipids and plasma triacylglycerol (by 70%) and cholesterol (by 48%); it also decreased kidney inflammatory and oxidative stress markers compared with vehicle-treated mice. These data support the idea that LXR plays an important role in the normal and diabetic kidney, while showing that LXR, through its inhibitory effect on inflammation and cholesterol accumulation in glomeruli, could also be a novel therapeutic target for DN. Show less
no PDF DOI: 10.1007/s00125-013-3095-6
NR1H3
Xiaoyan Zhang, Jia Liu, Wen Su +7 more · 2014 · Journal of diabetes · Blackwell Publishing · added 2026-04-24
Liver X receptors (LXRs) including LXRα and LXRβ are members of the nuclear hormone receptor superfamily of ligand activated transcription factors, which serve as lipid sensors to regulate expression Show more
Liver X receptors (LXRs) including LXRα and LXRβ are members of the nuclear hormone receptor superfamily of ligand activated transcription factors, which serve as lipid sensors to regulate expression of genes controlling many aspects of cholesterol and fatty acid metabolism. The liver is the central organ in controlling lipid metabolism. In the present study, we aimed at elucidating the role of LXR activation in hepatic fatty acid homeostasis. We treated C57BL/6 mice with a synthetic non-selective LXR agonist TO901317. Fatty acid profile of lipid esters in the livers was analyzed by gas-liquid chromatography. Real-time polymerase chain reaction (PCR) and western blot were used to determine the expression of SREBP1c and SCD1 in TO901317-treated livers and HepG2 cells. Oral administration of TO901317 resulted in increased fatty acid desaturation in the liver, with concomitant increase in hepatic stearoyl CoA desaturase-1 (SCD1) expression. TO901317-induced SCD1 expression was observed in LXRβ-/- mice, but not in LXRα-/- mice. Furthermore, TO901317 significantly increased expression of sterol regulatory element-binding protein 1c (SREBP1c), the deficiency of which almost completely abolished the induction of SCD1 by TO901317. This drug induced both SREBP1c and SCD1 expression in HepG2 cells. Overexpression of SREBP1c resulted in a significant increase in SCD1 promoter activity and expression. Taken together, the present studies demonstrate that pan-LXR activation increases hepatic fatty acid desaturation via the induction of SCD1 expression in an LXRα-dependent and SREBP1c-mediated manner. Show less
no PDF DOI: 10.1111/1753-0407.12081
NR1H3
Yong Zhang, Lifeng Wang, Jiachao Zhang +6 more · 2014 · European journal of nutrition · Springer · added 2026-04-24
To evaluate the preventive and therapeutic effects of Lactobacilluscasei Zhang on impaired glucose tolerance (IGT) by using fructose-induced hyperinsulinemia rats. Rats were fed 25 % fructose solution Show more
To evaluate the preventive and therapeutic effects of Lactobacilluscasei Zhang on impaired glucose tolerance (IGT) by using fructose-induced hyperinsulinemia rats. Rats were fed 25 % fructose solution for hyperinsulinemia with L.casei Zhang for prevention or therapy. Serum levels of insulin, glucagon-like peptide-2 (GLP-2), osteocalcin, malondialdehyde (MDA), total intestinal bile acids and hepatic glycogen contents were determined by assay kits. The major bacteria from feces and liver expression of adiponectin receptor 2 (AdipoR2), liver X receptor-α (LXR-α), peroxisome proliferator-activated receptor gamma (PPAR-γ) and vitamin K epoxide reductase complex subunit 1 mRNA were assessed by RT-PCR. Pancreas injury was evaluated by histological analysis. Lactobacilluscasei Zhang significantly increased numbers of Lactobacillus and Bifidobacterium and decreased Clostridium in the intestine (p < 0.01). Meanwhile, liver glycogen contents were significantly decreased (p < 0.05). In preventive group, accompanied by significantly lower insulin and GLP-2 levels (p < 0.05), L.casei Zhang prevented rats from an increase in oral glucose tolerance area under curve (AUC) which was significant in hyperinsulinemia group (p < 0.05). In therapeutic group, L.casei Zhang administration possessed improved glucose tolerance (p < 0.05), which were associated with increased osteocalcin level (p < 0.01), improved intestinal bile acids secretion (p = 0.060), decreased serum MDA levels (p < 0.05) and upregulation of LXR-α, PPAR-γ and AdipoR2 gene expression, as well as an increase in Bacteroides fragilis (p < 0.05). Lactobacilluscasei Zhang administration exert both preventive and ameliorative effect on oral glucose tolerance AUC in IGT rats but may be via different mechanisms. L.casei Zhang could prevent rats from increased AUC through GLP-2 lowering, while the ameliorative effect in high-fructose-fed post-adolescent rats may be via B. fragilis enriched vitamin K2-dependent osteocalcin mechanism in which AdipoR2, LXR-α and PPAR-γ signaling were involved. Show less
no PDF DOI: 10.1007/s00394-013-0519-5
NR1H3
Zhenda Wang, Jia Hu, Ge Li +6 more · 2014 · Autophagy · added 2026-04-24
Autophagy is a multistep process that involves the degradation and digestion of intracellular components by the lysosome. It has been proved that many core autophagy-related molecules participate in t Show more
Autophagy is a multistep process that involves the degradation and digestion of intracellular components by the lysosome. It has been proved that many core autophagy-related molecules participate in this event. However, new component proteins that regulate autophagy are still being discovered. At present, we report PHF23 (PHD finger protein 23) with a PHD-like zinc finger domain that can negatively regulate autophagy. Data from experiments indicated that the overexpression of PHF23 impaired autophagy, as characterized by decreased levels of LC3B-II and weakened degradation of endogenous and exogenous autophagic substrates. Conversely, knockdown of PHF23 resulted in opposite effects. Molecular mechanism studies suggested that PHF23 interacts with LRSAM1, which is an E3 ligase key for ubiquitin-dependent autophagy against invading bacteria. PHF23 promotes the ubiquitination and proteasome degradation of LRSAM1. We also show that the PHD finger of PHF23 is a functional domain needed for the interaction with LRSAM1. Altogether, our results indicate that PHF23 is a negative regulator associated in autophagy via the LRSAM1 signaling pathway. The physical and functional connection between the PHF23 and LRSAM1 needs further investigation. Show less
no PDF DOI: 10.4161/auto.36439
PIK3C3
Fengliang Wang, Yafang Yang, Ziyi Fu +6 more · 2014 · Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie · Elsevier · added 2026-04-24
Breast cancer has been considered to be a multifactorial disease with a wide array of well-characterized gene mutations and chromosomal abnormalities. However, it is becoming evident that the onset or Show more
Breast cancer has been considered to be a multifactorial disease with a wide array of well-characterized gene mutations and chromosomal abnormalities. However, it is becoming evident that the onset or development of breast cancer also depends on epigenetic factors, although the mechanisms have not been fully elucidated. We performed a genome-wide analysis of DNA methylation of breast carcinomatous tissues and paired normal tissues to examine the differences in methylation between them. Methylation-specific polymerase chain reaction (MSP) was used to validate the hypermethylated genes screened out by DNA methylation microarray. We found that hypomethylation and hypermethylation occurred in 2753 and 1795 genes, respectively, in breast carcinomatous tissues. Meanwhile, gene ontology analysis and ingenuity pathway analysis revealed the function and pathway of several genes whose methylation status was altered in breast carcinomatous tissues. In addition, we investigated the promoter methylation status of four genes in breast carcinomatous tissue and paired normal tissues (n=30) by MSP. Promoter hypermethylation of CRABP1, HOXB13, IFNGR2, and PIK3C3 was found in 37% (11/30), 23% (7/30), 17% (5/30), and 2% (2/30) of the carcinomas, respectively. Mutation of these four important genes was critical to many types of cancer. Our results suggest that DNA methylation mechanisms may be involved in regulating the occurrence and development of breast cancer. Show less
no PDF DOI: 10.1016/j.biopha.2014.07.014
PIK3C3
Pei Wang, Tian-Ying Xu, Kai Wei +6 more · 2014 · Autophagy · added 2026-04-24
Autophagy, a highly conserved process conferring cytoprotection against stress, contributes to the progression of cerebral ischemia. β-arrestins are multifunctional proteins that mediate receptor dese Show more
Autophagy, a highly conserved process conferring cytoprotection against stress, contributes to the progression of cerebral ischemia. β-arrestins are multifunctional proteins that mediate receptor desensitization and serve as important signaling scaffolds involved in numerous physiopathological processes. Here, we show that both ARRB1 (arrestin, β 1) and ARRB2 (arrestin, β 2) were upregulated by cerebral ischemic stress. Knockout of Arrb1, but not Arrb2, aggravated the mortality, brain infarction, and neurological deficit in a mouse model of cerebral ischemia. Accordingly, Arrb1-deficient neurons exhibited enhanced cell injury upon oxygen-glucose deprivation (OGD), an in vitro model of ischemia. Deletion of Arrb1 did not affect the cerebral ischemia-induced inflammation, oxidative stress, and nicotinamide phosphoribosyltransferase upregulation, but markedly suppressed autophagy and induced neuronal apoptosis/necrosis in vivo and in vitro. Additionally, we found that ARRB1 interacted with BECN1/Beclin 1 and PIK3C3/Vps34, 2 major components of the BECN1 autophagic core complex, under the OGD condition but not normal conditions in neurons. Finally, deletion of Arrb1 impaired the interaction between BECN1 and PIK3C3, which is a critical event for autophagosome formation upon ischemic stress, and markedly reduced the kinase activity of PIK3C3. These findings reveal a neuroprotective role for ARRB1, in the context of cerebral ischemia, centered on the regulation of BECN1-dependent autophagosome formation. Show less
no PDF DOI: 10.4161/auto.29203
PIK3C3
Pengyan Xia, Shuo Wang, Guanling Huang +4 more · 2014 · Cell research · Nature · added 2026-04-24
WASH (Wiskott-Aldrich syndrome protein (WASP) and SCAR homolog) was identified to function in endosomal sorting via Arp2/3 activation. We previously demonstrated that WASH is a new interactor of BECN1 Show more
WASH (Wiskott-Aldrich syndrome protein (WASP) and SCAR homolog) was identified to function in endosomal sorting via Arp2/3 activation. We previously demonstrated that WASH is a new interactor of BECN1 and present in the BECN1-PIK3C3 complex with AMBRA1. The AMBRA1-DDB1-CUL4A complex is an E3 ligase for K63-linked ubiquitination of BECN1, which is required for starvation-induced autophagy. WASH suppresses autophagy by inhibition of BECN1 ubiquitination. However, how AMBRA1 is regulated during autophagy remains elusive. Here, we found that RNF2 associates with AMBRA1 to act as an E3 ligase to ubiquitinate AMBRA1 via K48 linkage. RNF2 mediates ubiquitination of AMBRA1 at lysine 45. Notably, RNF2 deficiency enhances autophagy induction. Upon autophagy induction, RNF2 potentiates AMBRA1 degradation with the help of WASH. WASH deficiency impairs the association of RNF2 with AMBRA1 to impede AMBRA1 degradation. Our findings reveal another novel layer of regulation of autophagy through WASH recruitment of RNF2 for AMBRA1 degradation leading to downregulation of autophagy. Show less
no PDF DOI: 10.1038/cr.2014.85
PIK3C3
G A Doyle, C L Schwebel, S E Ruiz +7 more · 2014 · Neuroscience · Elsevier · added 2026-04-24
Compared to DBA/2J (D2), C57BL/6J (B6) inbred mice exhibit strong morphine preference when tested using a two-bottle choice drinking paradigm. A morphine preference quantitative trait locus (QTL), Mop Show more
Compared to DBA/2J (D2), C57BL/6J (B6) inbred mice exhibit strong morphine preference when tested using a two-bottle choice drinking paradigm. A morphine preference quantitative trait locus (QTL), Mop2, was originally mapped to proximal chromosome (Chr) 10 using a B6xD2 F2 intercross population, confirmed with reciprocal congenic strains and fine mapped with recombinant congenic strains. These efforts identified a ∼ 10-Million base pair (Mbp) interval, underlying Mop2, containing 35 genes. To further reduce the interval, mice from the D2.B6-Mop2-P1 congenic strain were backcrossed to parental D2 mice and two new recombinant strains of interest were generated: D2.B6-Mop2-P1.pD.dB and D2.B6-Mop2-P1.pD.dD. Results obtained from testing these strains in the two-bottle choice drinking paradigm suggest that the gene(s) responsible for the Mop2 QTL is one or more of 22 remaining within the newly defined interval (∼ 7.6 Mbp) which includes Oprm1 and several other genes related to opioid pharmacology. Real-time qRT-PCR analysis of Oprm1 and opioid-related genes Rgs17, Ppp1r14c, Vip, and Iyd revealed both between-strain and within-strain expression differences in comparisons of saline- and morphine-treated B6 and D2 mice. Analysis of Rgs17 protein levels also revealed both between-strain and within-strain differences in comparisons of saline- and morphine-treated B6 and D2 mice. Results suggest that the Mop2 QTL represents the combined influence of multiple genetic variants on morphine preference in these two strains. Relative contributions of each variant remain to be determined. Show less
no PDF DOI: 10.1016/j.neuroscience.2014.07.020
RGS17
Yanchao Jiang, Haibo Wang, David Culp +6 more · 2014 · Investigative ophthalmology & visual science · added 2026-04-24
To determine whether knockdown of Müller cell-derived VEGFA-splice variant, VEGF164, which is upregulated in the rat retinopathy of prematurity (ROP) model, safely inhibits intravitreal neovasculariza Show more
To determine whether knockdown of Müller cell-derived VEGFA-splice variant, VEGF164, which is upregulated in the rat retinopathy of prematurity (ROP) model, safely inhibits intravitreal neovascularization (IVNV). Short hairpin RNAs for VEGF164 (VEGF164.shRNAs) or luciferase.shRNA control were cloned into lentivectors with CD44 promoters that specifically target Müller cells. Knockdown efficiency, off-target effects, and specificity were tested in HEK reporter cell lines that expressed green fluorescent protein (GFP)-tagged VEGF164 or VEGF120 with flow cytometry or in rat Müller cells (rMC-1) by real-time PCR. In the rat oxygen-induced retinopathy (OIR) ROP model, pups received 1 μL subretinal lentivector-driven luciferase.shRNA, VEGFA.shRNA, or VEGF164.shRNA at postnatal day 8 (P8). Analyses at P18 and P25 included: IVNV and avascular retina (AVA); retinal and serum VEGF (ELISA); density of phosphorylated VEGFR2 (p-VEGFR2) in lectin-labeled retinal endothelial cells (ECs; immunohistochemistry); TUNEL staining and thickness of inner nuclear (INL) and outer nuclear layers (ONL) in retinal cryosections; and pup weight gain. In HEK reporter and in rMC-1 cells and in comparison to lucifferase.shRNA, VEGFA.shRNA reduced both VEGF120 and VEGF164, but VEGF164.shRNA only reduced VEGF164 and not VEGF120. Compared with luciferase.shRNA, VEGFA.shRNA and VEGF164.shRNA reduced retinal VEGF and IVNV without affecting AVA at P18 and P25. At P25, VEGF164.shRNA more effectively maintained IVNV inhibition than VEGFA.shRNA. VEGFA.shRNA and VEGF164.shRNA reduced pVEGFR2 in retinal ECs at P18, but VEGFA.shRNA increased it at P25. VEGFA.shRNA increased TUNEL+ cells at P18 and decreased ONL thickness at P18 and P25. VEGFA.shRNA and VEGF164.shRNA did not affect pup weight gain and serum VEGF. Short hairpin RNA to Müller cell VEGF164 maintained long-term inhibition of IVNV and limited cell death compared with shRNA to VEGFA. Show less
no PDF DOI: 10.1167/iovs.13-13755
RMC1
Jin-Gyoung Jung, Alexander Stoeck, Bin Guan +5 more · 2014 · PLoS genetics · PLOS · added 2026-04-24
The Notch3 signaling pathway is thought to play a critical role in cancer development, as evidenced by the Notch3 amplification and rearrangement observed in human cancers. However, the molecular mech Show more
The Notch3 signaling pathway is thought to play a critical role in cancer development, as evidenced by the Notch3 amplification and rearrangement observed in human cancers. However, the molecular mechanism by which Notch3 signaling contributes to tumorigenesis is largely unknown. In an effort to identify the molecular modulators of the Notch3 signaling pathway, we screened for Notch3-intracellular domain (N3-ICD) interacting proteins using a human proteome microarray. Pathway analysis of the Notch3 interactome demonstrated that ubiquitin C was the molecular hub of the top functional network, suggesting the involvement of ubiquitination in modulating Notch3 signaling. Thereby, we focused on functional characterization of an E3 ubiquitin-protein ligase, WWP2, a top candidate in the Notch3 interactome list. Co-immunoprecipitation experiments showed that WWP2 interacted with N3-ICD but not with intracellular domains from other Notch receptors. Wild-type WWP2 but not ligase-deficient mutant WWP2 increases mono-ubiquitination of the membrane-tethered Notch3 fragment, therefore attenuating Notch3 pathway activity in cancer cells and leading to cell cycle arrest. The mono-ubiquitination by WWP2 may target an endosomal/lysosomal degradation fate for Notch3 as suggested by the fact that the process could be suppressed by the endosomal/lysosomal inhibitor. Analysis of The Cancer Genome Atlas dataset showed that the majority of ovarian carcinomas harbored homozygous or heterozygous deletions in WWP2 locus, and there was an inverse correlation in the expression levels between WWP2 and Notch3 in ovarian carcinomas. Furthermore, ectopic expression of WWP2 decreased tumor development in a mouse xenograft model and suppressed the Notch3-induced phenotypes including increase in cancer stem cell-like cell population and platinum resistance. Taken together, our results provide evidence that WWP2 serves as a tumor suppressor by negatively regulating Notch3 signaling in ovarian cancer. Show less
no PDF DOI: 10.1371/journal.pgen.1004751
WWP2
Lan Fang, Ling Zhang, Wei Wei +6 more · 2014 · Molecular cell · Elsevier · added 2026-04-24
Sox2 is a key factor for maintaining embryonic stem cell (ESS) pluripotency, but little is known about its posttranslational regulation. Here we present evidence that the precise level of Sox2 protein Show more
Sox2 is a key factor for maintaining embryonic stem cell (ESS) pluripotency, but little is known about its posttranslational regulation. Here we present evidence that the precise level of Sox2 proteins in ESCs is regulated by a balanced methylation and phosphorylation switch. Set7 monomethylates Sox2 at K119, which inhibits Sox2 transcriptional activity and induces Sox2 ubiquitination and degradation. The E3 ligase WWP2 specifically interacts with K119-methylated Sox2 through its HECT domain to promote Sox2 ubiquitination. In contrast, AKT1 phosphorylates Sox2 at T118 and stabilizes Sox2 by antagonizing K119me by Set7 and vice versa. In mouse ESCs, AKT1 activity toward Sox2 is greater than that of Set7, leading to Sox2 stabilization and ESC maintenance. In early development, increased Set7 expression correlates with Sox2 downregulation and appropriate differentiation. Our study highlights the importance of a Sox2 methylation-phosphorylation switch in determining ESC fate. Show less
no PDF DOI: 10.1016/j.molcel.2014.06.018
WWP2
Xinlong Luo, Beibei Wang, Fan Tang +4 more · 2014 · Biochemical and biophysical research communications · Elsevier · added 2026-04-24
SRG3 plays essential roles both in early mouse embryogenesis and in extra-embryonic vascular development. As one of the core components of the SWI/SNF-like BAF complex, SRG3 serves as the scaffold pro Show more
SRG3 plays essential roles both in early mouse embryogenesis and in extra-embryonic vascular development. As one of the core components of the SWI/SNF-like BAF complex, SRG3 serves as the scaffold protein and its protein level controls the stability of the BAF complex, which controls diverse physiological processes through transcriptional regulation. However, little is known about how the protein level of SRG3 is regulated in mammalian cells. Previously, we identified a murine ubiquitin ligase (Wwp2) and demonstrated that it interacts with pluripotency-associated key transcription factor Oct4 and RNA polymerase II large subunit Rpb1, promoting their ubiquitination and degradation. Here, we report that Wwp2 acts as a ubiquitin ligase of SRG3. Our results show that Wwp2 and SRG3 form protein complexes and co-localize in the nucleus in mammalian cells. The interaction is mediated through the WW domain of Wwp2 and the PPPY motif of SRG3, respectively. Importantly, Wwp2 promotes ubiquitination and degradation of SRG3 through the ubiquitin-proteasome system. The expression of a catalytically inactive mutant of Wwp2 abolishes SRG3 ubiquitination. Collectively, our study opens up a new avenue to understand how the protein level of SRG3 is regulated in mammalian cells. Show less
no PDF DOI: 10.1016/j.bbrc.2013.12.089
WWP2
Lynn Htet Htet Aung, Rui-Xing Yin, Dong-Feng Wu +3 more · 2014 · Journal of cellular and molecular medicine · Blackwell Publishing · added 2026-04-24
The single nucleotide polymorphisms (SNPs) in the BUD13 homolog (BUD13) and zinc finger protein 259 (ZNF259) genes have been associated with one or more serum lipid traits in the European populations. Show more
The single nucleotide polymorphisms (SNPs) in the BUD13 homolog (BUD13) and zinc finger protein 259 (ZNF259) genes have been associated with one or more serum lipid traits in the European populations. However, little is known about such association in the Chinese populations. Our objectives were to determine the association of the BUD13/ZNF259 SNPs and their haplotypes with hypercholesterolaemia (HCH)/hypertriglyceridaemia (HTG) and to identify the possible gene-gene interactions among these SNPs. Genotyping of 6 SNPs was performed in 634 hyperlipidaemic and 547 normolipidaemic participants. The ZNF259 rs2075290, ZNF259 rs964184 and BUD13 rs10790162 SNPs were significantly associated with serum lipid levels in both HCH and non-HCH populations (P < 0.008-0.001). On single locus analysis, only BUD13 rs10790162 was associated with HCH (OR: 2.23, 95% CI: 1.05, 4.75, P = 0.015). The G-G-A-A-C-C haplotype, carrying rs964184-G-allele, was associated with increased risk of HCH (OR: 1.35, 95% CI: 1.10, 1.66, P = 0.005) and HTG (OR: 1.75, 95% CI: 1.39, 2.21, P = 0.000). The A-C-G-G-C-C and A-C-A-G-T-C haplotypes, carrying rs964184-C-allele, were associated with reduced risk of HCH (OR: 0.77, 95% CI: 0.61, 0.99, P = 0.039 and OR: 0.66, 95% CI: 0.47, 0.94, P = 0.021 respectively). On multifactor dimensionality reduction analyses, the two- to three-locus models showed a significant association with HCH and HTG (P < 0.01-0.001). The BUD13/ZNF259 SNPs, which were significant in the European populations, are also replicable in the Southern Chinese population. Moreover, inter-locus interactions may exist among these SNPs. However, further functional studies are required to clarify how these SNPs and genes actually affect the serum lipid levels. Show less
no PDF DOI: 10.1111/jcmm.12291
ZPR1
Lynn Htet Htet Aung, Rui-Xing Yin, Dong-Feng Wu +3 more · 2014 · International journal of medical sciences · added 2026-04-24
Little is known about the association of ZNF259 rs2075290 single nucleotide polymorphism (SNP) and serum lipid levels in the Chinese population. This study aimed to detect the association of ZNF259 rs Show more
Little is known about the association of ZNF259 rs2075290 single nucleotide polymorphism (SNP) and serum lipid levels in the Chinese population. This study aimed to detect the association of ZNF259 rs2075290 SNP and environmental factors with serum lipid levels between males and females in the Mulao and Han populations. Genotyping of ZNF259 rs2075290 SNP was performed in 788 of Mulao and 778 of Han participants using polymerase chain reaction and restriction fragment length polymorphism. The genotype frequencies were significantly different between Mulao and Han populations (AA, 50.1% Vs 58.9%; AG, 42.3% Vs 35.7%; GG, 7.6% Vs 5.4%, P = 0.002) and between Han males and females (AA, 64.5% Vs 55.2%; AG, 28.3% Vs 40.6%; GG, 7.2% Vs 4.2%, P = 0.001). Serum levels of triglyceride (TG) in Mulao males, and total cholesterol (TC), TG and low-density lipoprotein cholesterol (LDL-C) in Mulao females were different between the AA and AG/GG genotypes (P < 0.05-0.001). Serum TC, LDL-C and apolipoprotein (Apo) A1 levels in Han males, and TG and ApoB levels and ApoA1/ApoB ratio in Han females were different between the AA and AG/GG genotypes (P < 0.05-0.001). An interaction between ZNF259 rs2075290 polymorphism and male gender on serum TC, LDL-C, and ApoA1 levels was noted in Han population (P < 0.05-0.01) but not in Mulao's. The subjects with AG/GG genotype in Mulao males and females and Han females have less favorable lipid profiles than those with AA genotype. In contrast, the subjects with AG/GG genotype in Han males have more favorable lipid profiles than those with AA genotype. These findings suggest that the association between ZNF259 rs2075290 SNP and serum lipid levels might have ethnic- and/or sex-specificity. Show less
no PDF DOI: 10.7150/ijms.8489
ZPR1
Scott K Sherman, Jennifer C Carr, Donghong Wang +3 more · 2013 · Surgery · Elsevier · added 2026-04-24
Ligands binding the somatostatin receptor type 2 (SSTR2) are useful for imaging and treatment of neuroendocrine tumors (NETs), but not all tumors express high levels of these receptors. The aim of thi Show more
Ligands binding the somatostatin receptor type 2 (SSTR2) are useful for imaging and treatment of neuroendocrine tumors (NETs), but not all tumors express high levels of these receptors. The aim of this study was to evaluate gene expression of new therapeutic targets in NETs relative to SSTR2. RNA was extracted from 103 primary small bowel and pancreatic NETs, matched normal tissue, and 123 metastases. Expression of 12 candidate genes was measured by quantitative polymerase chain reaction normalized to internal controls; candidate gene expression was compared with SSTR2. Relative to normal tissue, primary NET expression of SSTR2, GPR98, BRS3, GIPR, GRM1, and OPRK1 were increased by 3, 8, 13, 13, 17, and 20-fold, respectively. Similar changes were found in metastases. Although most candidate genes showed lesser absolute expressions than SSTR2, absolute GIPR expression was closest to SSTR2 (mean dCT 3.6 vs. 2.7, P = .01). Absolute OPRK1 and OXTR expression varied greatly by primary tumor type and was close to SSTR2 in small bowel NETs but not pancreatic NETs. Compared with the current treatment standard SSTR2, GIPR has only somewhat lesser absolute gene expression in tumor tissue but much lesser expression in normal tissue, making it a promising new target for NET imaging and therapy. Show less
📄 PDF DOI: 10.1016/j.surg.2013.04.052
GIPR
Mohamed Bessat, Giselle Knudsen, Alma L Burlingame +1 more · 2013 · PloS one · PLOS · added 2026-04-24
The anaphase-promoting complex/cyclosome (APC/C) is a multi-subunit E3 ubiquitin ligase that initiates chromosome segregation and mitotic exit by targeting critical cell-cycle regulators for proteolyt Show more
The anaphase-promoting complex/cyclosome (APC/C) is a multi-subunit E3 ubiquitin ligase that initiates chromosome segregation and mitotic exit by targeting critical cell-cycle regulators for proteolytic destruction. Previously, seven APC/C subunit homologues were identified in the genome of Trypanosoma brucei. In the present study, we tested five of them in yeast complementation studies and found none of them capable of complementing the yeast mutants lacking the corresponding subunits, suggesting significant discrepancies between the two APC/C's. Subunit homologues of mitotic checkpoint complex (MCC) have not yet been identified in T. brucei, raising the possibility that a MCC-APC/C complex equivalent may not exist in T. brucei. We performed tandem affinity purification of the protein complex containing a APC1 fusion protein expressed in the cells enriched in different phases of the cell cycle of procyclic form T. brucei, and compared their protein profiles using LC-MS/MS analyses. The seven putative APC/C subunits were identified in the protein complex throughout the cell cycle together with three additional proteins designated the associated proteins (AP) AP1, AP2 and AP3. Abundance of the 10 proteins remained relatively unchanged throughout the cell cycle, suggesting that they are the core subunits of APC/C. AP1 turned out to be a homologue of APC4. An RNAi knockdown of APC4 and AP3 showed no detectable cellular phenotype, whereas an AP2 knockdown enriched the cells in G2/M phase. The AP2-depleted cells showed stabilized mitotic cyclin B. An accumulation of poly-ubiquitinated cyclin B was indicated in the cells treated with the proteasome inhibitor MG132, demonstrating the involvement of proteasome in degrading poly-ubiquitinated cyclin B. In all, a 10-subunit APC/C machinery with a conserved function is identified in T. brucei without linking to a MCC-like complex, thus indicating a unique T. brucei APC/C. Show less
📄 PDF DOI: 10.1371/journal.pone.0059258
ANAPC4
Yanbing Wang, Yingnan Hou, Hongya Gu +4 more · 2013 · Journal of integrative plant biology · Blackwell Publishing · added 2026-04-24
Anaphase-promoting complex/cyclosome (APC/C), a multisubunit E3 ligase, plays a critical role in cell cycle control, but the functional characterization of each subunit has not yet been completed. To Show more
Anaphase-promoting complex/cyclosome (APC/C), a multisubunit E3 ligase, plays a critical role in cell cycle control, but the functional characterization of each subunit has not yet been completed. To investigate the function of APC1 in Arabidopsis, we analyzed four mutant alleles of APC1, and found that mutation in APC1 resulted in significantly reduced plant fertility, accumulation of cyclin B, and disrupted auxin distribution in embryos. The three mutant alleles apc1-1, apc1-2 and apc1-3 shared variable defects in female gametogenesis including degradation, abnormal nuclear number, and disrupted polarity of nuclei in the embryo sac as well as in embryogenesis, in which embryos were arrested at multiple stages. All of these defects are similar to those previously identified in apc4. The mutant apc1-4, in which the T-DNA was inserted after the transmembrane domain at the C-terminus, showed much more severe phenotypes; that is, most of the ovules were arrested at the one-nucleate female gametophyte stage (stage FG1). In the apc1 apc4 double mutants, the fertility was further reduced by one-third in apc1-1/+ apc4-1/+, and in some cases no ovules even survived in siliques of apc1-4/+ apc4-1/+. Our data thus suggest that APC1, an essential component of APC/C, plays a synergistic role with APC4 both in female gametogenesis and in embryogenesis. Show less
no PDF DOI: 10.1111/jipb.12018
ANAPC4
Yuan-Yuan Zhang, Rui-Feng Duan, Wen-Yu Cui +5 more · 2013 · Zhongguo ying yong sheng li xue za zhi = Zhongguo yingyong shenglixue zazhi = Chinese journal of applied physiology · added 2026-04-24
High altitude pulmonary edema (HAPE), a life-threatening disease, has no biological markers used for the routine prevention, diagnosis and treatment. The aim of this study was to identify serum protei Show more
High altitude pulmonary edema (HAPE), a life-threatening disease, has no biological markers used for the routine prevention, diagnosis and treatment. The aim of this study was to identify serum proteins differentially expressed in patients with HAPE for discovering essential biomarkers. A complete serum proteomic analysis was performed on 10 HAPE patients and on 10 high altitude and 11 sea level healthy people as control using two-dimensional gel electrophoresis, followed by matrix-assisted laser desorption/ionization mass spectrometry and peptide mass fingerprinting. Finally, two most significantly changed proteins were validated by enzyme-linked immunosorbent assay (ELISA). Eight protein spots stained with differential intensity, respresenting 5 distinct proteins were identified in patients compared with healthy controls through analysis of these composite gels. Among them, four proteins, namely alpha 1-antitrypsin(alpha1-AT), Haptoglobin(Hp), apolipoprotein A-1 (apoA-1) and Complement C3 increased remarkably, while one protein, apolipoprotein A-IV (apoA-IV) decreased significantly. The variation of alpha1-AT and Haptoglobin, as detected by ELISA, was consistent with the results from proteomic analysis. It is well known that Hp, alpha1-AT and complement C3 are associated with inflammation and apoA-1 and apoA-IV play important roles in lipid absorption, transport and metabolism. Therefore, the significant expression changes of Hp, alpha1-AT and complement C3 and apoA-1 and apoA-IV between HAPE patients and their corresponding healthy controls highlight the role of inflammatory response system and lipid metabolism system in the pathophysiology of HAPE. Show less
no PDF
APOA4
Fei Wang, Kevin J Pearson, W Sean DavidsoN +1 more · 2013 · Physiology & behavior · Elsevier · added 2026-04-24
Rodent apoA-IV is expressed predominantly in small intestine and also expressed to a small extent in liver and hypothalamus. ApoA-IV has been shown to inhibit food intake in rats when injected central Show more
Rodent apoA-IV is expressed predominantly in small intestine and also expressed to a small extent in liver and hypothalamus. ApoA-IV has been shown to inhibit food intake in rats when injected centrally. In the current study, we hypothesize that a specific sequence within rat apoA-IV is responsible for mediating the anorectic effect. We use a bacterial expression system to generate truncation mutants (Δ249-371, Δ117-371 and Δ1-61) of rat apoA-IV and assess the ability of various regions of the molecule to inhibit food intake. The results indicate that a responsible sequence exists within the N-terminal 61 amino acids of rat apoA-IV. Synthetic peptides (1-30 EVTSDQVANVMWDYFTQLSNNAKEAVEQLQ, 1-15 EVTSDQVANVMWDYF and 17-30 QLSNNAKEAVEQLQ) were used to specify the region in between residues 1 and 30. A 14-mer peptide (17-30) encompassing this sequence was capable of reducing food intake in a dose-dependent manner whereas a peptide designed on a more C-terminal region (211-232) of apoA-IV (QEKLNHQMEGLAFQMKKNAEEL) failed to exhibit the dose-dependent anorectic effect. The isolation of this sequence provides a valuable tool for future work directed at identifying apoA-IV binding proteins and is a key step for exploring the potential of therapeutic manipulation of food intake via this pathway. Show less
📄 PDF DOI: 10.1016/j.physbeh.2013.07.010
APOA4
Jiabei Li, Mingbao Song, Dehui Qian +6 more · 2013 · Clinical and investigative medicine. Medecine clinique et experimentale · added 2026-04-24
The purpose of this study was to evaluate the relationship between apolipoprotein A-IV (apoA-IV) plasma concentrations and acute coronary syndrome (ACS). Plasma apoA-IV concentrations were measured in Show more
The purpose of this study was to evaluate the relationship between apolipoprotein A-IV (apoA-IV) plasma concentrations and acute coronary syndrome (ACS). Plasma apoA-IV concentrations were measured in 115 patients with different types of ACS and in 68 gender- and age-matched control subjects using Enzyme-Linked Immunosorbent Assay (ELISA) kits. The clinical data were collected by an internist, who was blinded to plasma apoA-IV concentrations. Plasma apoA-IV levels in ACS patients were significantly decreased compared to the levels in control subjects (437.0±157.5 μg/mL vs. 590.2±183.7 μg/mL, P<0.001). An statistically significant decreasing trend of plasma apoA-IV levels from the control subjects, to patients with unstable angina pectoris (UAP) (457.3±152.9 μg/mL), to patients with acute myocardial infarction (AMI) (311.7±127.8 μg/mL), was observed. Moreover, plasma apoA-IV level was negatively associated with New York Heart Association (NYHA) functional class. NYHA class II (467.2±142.1 μg/mL, P<0.001) and class III/IV (368.1±170.8 μg/mL, P<0.001) patients had statistically decreased levels of plasma apoA-IV when compared to the control subjects. A stepwise multivariate regression analysis identified types of ACS, NYHA classes, and plasma fibrinogen levels as the most important determinants of plasma apoA-IV levels in ACS patients. Low plasma apoA-IV levels are associated with ACS, and plasma apoA-IV levels may be a potential treatment target for ACS patients. Show less
no PDF DOI: 10.25011/cim.v36i4.19954
APOA4